Free for academic non-profit institutions. Other users need a Commercial license

Aliases for UBE2E3 Gene

Aliases for UBE2E3 Gene

  • Ubiquitin Conjugating Enzyme E2 E3 2 3 5
  • Ubiquitin-Conjugating Enzyme E2E 3 (Homologous To Yeast UBC4/5) 2 3
  • Ubiquitin-Conjugating Enzyme E2E 3 (UBC4/5 Homolog, Yeast) 2 3
  • Ubiquitin-Conjugating Enzyme E2-23 KDa 3 4
  • E2 Ubiquitin-Conjugating Enzyme E3 3 4
  • Ubiquitin Carrier Protein E3 3 4
  • Ubiquitin-Protein Ligase E3 3 4
  • UBCH9 3 4
  • Ubiquitin-Conjugating Enzyme E2E 3 2
  • Ubiquitin Conjugating Enzyme E2E 3 3
  • Ubiquitin-Conjugating Enzyme E2 E3 3
  • EC 6.3.2.19 61
  • EC 2.3.2.23 4
  • UbcM2 3
  • UBCE4 4

External Ids for UBE2E3 Gene

Previous GeneCards Identifiers for UBE2E3 Gene

  • GC02P180033
  • GC02P180529
  • GC02P181809
  • GC02P182047
  • GC02P181670
  • GC02P181553
  • GC02P173700

Summaries for UBE2E3 Gene

Entrez Gene Summary for UBE2E3 Gene

  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse and rat counterparts, which indicates that this enzyme is highly conserved in eukaryotes. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2013]

GeneCards Summary for UBE2E3 Gene

UBE2E3 (Ubiquitin Conjugating Enzyme E2 E3) is a Protein Coding gene. Diseases associated with UBE2E3 include Parkinson Disease, Late-Onset. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and acid-amino acid ligase activity. An important paralog of this gene is UBE2E2.

UniProtKB/Swiss-Prot for UBE2E3 Gene

  • Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-11- and Lys-48-, as well as Lys-63-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.

Gene Wiki entry for UBE2E3 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for UBE2E3 Gene

Genomics for UBE2E3 Gene

Regulatory Elements for UBE2E3 Gene

Enhancers for UBE2E3 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH02G181036 0.7 ENCODE 20.6 +70.2 70222 2.4 MTA2 HLF CEBPB CEBPG JUND ZNF316 CREB1 FOS EMSY MAFK UBE2E3 LOC105373772 ITGA4 LINC01934
GH02G181123 1.4 Ensembl ENCODE dbSUPER 10 +158.9 158940 5.4 PKNOX1 ATF1 TBL1XR1 BMI1 CBX5 FOS RELB ETV6 IKZF2 CREM ITGA4 UBE2E3 ENSG00000238171 MIR4437
GH02G181303 1.9 FANTOM5 Ensembl ENCODE dbSUPER 7 +342.4 342419 11.6 PKNOX1 FOXA2 ATF1 MLX WRNIP1 ARID4B DMAP1 GATA2 CBX5 SP5 ITGA4 UBE2E3 MIR4437 GC02P181326
GH02G180978 1.1 ENCODE 10.8 +13.6 13613 4.2 ARNT CREB3L1 ZFP64 SIN3A DMAP1 SLC30A9 ZNF766 ZNF143 ZNF207 SP5 UBE2E3 LOC105373772 LINC01934
GH02G181139 1.4 FANTOM5 Ensembl ENCODE dbSUPER 8.4 +174.2 174219 4.1 STAT1 ATF3 HLF CEBPB PRDM1 ITGA4 UBE2E3 ENSG00000238171 MIR4437
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around UBE2E3 on UCSC Golden Path with GeneCards custom track

Genomic Location for UBE2E3 Gene

Chromosome:
2
Start:
180,967,248 bp from pter
End:
181,076,585 bp from pter
Size:
109,338 bases
Orientation:
Plus strand

Genomic View for UBE2E3 Gene

Genes around UBE2E3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
UBE2E3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for UBE2E3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for UBE2E3 Gene

Proteins for UBE2E3 Gene

  • Protein details for UBE2E3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q969T4-UB2E3_HUMAN
    Recommended name:
    Ubiquitin-conjugating enzyme E2 E3
    Protein Accession:
    Q969T4
    Secondary Accessions:
    • B2RAD6
    • D3DPG3
    • Q5U0R7
    • Q7Z4W4

    Protein attributes for UBE2E3 Gene

    Size:
    207 amino acids
    Molecular mass:
    22913 Da
    Quaternary structure:
    • The ubiquitin-loaded form interacts specifically with importin-11 (IPO11), leading to its import into the nucleus. Interacts with NEDD4L.

neXtProt entry for UBE2E3 Gene

Selected DME Specific Peptides for UBE2E3 Gene

Q969T4:
  • STILGPPGSVYEGGVFFLDI
  • EHDRIAR
  • YPFKPPK
  • SKVLLSICSLLTD
  • TNRAEHDR
  • ICLDILK
  • ITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVF

Post-translational modifications for UBE2E3 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

Domains & Families for UBE2E3 Gene

Gene Families for UBE2E3 Gene

Suggested Antigen Peptide Sequences for UBE2E3 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q969T4

UniProtKB/Swiss-Prot:

UB2E3_HUMAN :
  • Belongs to the ubiquitin-conjugating enzyme family.
Family:
  • Belongs to the ubiquitin-conjugating enzyme family.
genes like me logo Genes that share domains with UBE2E3: view

Function for UBE2E3 Gene

Molecular function for UBE2E3 Gene

GENATLAS Biochemistry:
ubiquitin conjugating enzyme E2E3,homologous to yeast UBC4/5,expressed in skeletal muscle
UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.
UniProtKB/Swiss-Prot Function:
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-11- and Lys-48-, as well as Lys-63-linked polyubiquitination. Participates in the regulation of transepithelial sodium transport in renal cells. May be involved in cell growth arrest.

Enzyme Numbers (IUBMB) for UBE2E3 Gene

Gene Ontology (GO) - Molecular Function for UBE2E3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004842 ubiquitin-protein transferase activity IDA 20061386
GO:0005515 protein binding IPI 14667819
GO:0005524 ATP binding IEA --
GO:0016740 transferase activity IEA --
GO:0061631 ubiquitin conjugating enzyme activity IEA --
genes like me logo Genes that share ontologies with UBE2E3: view
genes like me logo Genes that share phenotypes with UBE2E3: view

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for UBE2E3 Gene

Localization for UBE2E3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for UBE2E3 Gene

Nucleus. Cytoplasm. Note=Shuttles between the nucleus and cytoplasm in a IPO11-dependent manner.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for UBE2E3 gene
Compartment Confidence
nucleus 5
cytosol 5

Gene Ontology (GO) - Cellular Components for UBE2E3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with UBE2E3: view

Pathways & Interactions for UBE2E3 Gene

genes like me logo Genes that share pathways with UBE2E3: view

Pathways by source for UBE2E3 Gene

UniProtKB/Swiss-Prot Q969T4-UB2E3_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for UBE2E3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0016567 protein ubiquitination TAS --
GO:0040008 regulation of growth IEA --
GO:0070534 protein K63-linked ubiquitination IDA 20061386
GO:0070936 protein K48-linked ubiquitination IDA 20061386
GO:0070979 protein K11-linked ubiquitination IDA 20061386
genes like me logo Genes that share ontologies with UBE2E3: view

No data available for SIGNOR curated interactions for UBE2E3 Gene

Drugs & Compounds for UBE2E3 Gene

(7) Drugs for UBE2E3 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved Nutra 0
Adenosine triphosphate Approved Nutra 0

(4) Additional Compounds for UBE2E3 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
sodium
  • Sodium
  • Sodium ion
7440-23-5
genes like me logo Genes that share compounds with UBE2E3: view

Transcripts for UBE2E3 Gene

Unigene Clusters for UBE2E3 Gene

Ubiquitin-conjugating enzyme E2E 3:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for UBE2E3 Gene

No ASD Table

Relevant External Links for UBE2E3 Gene

GeneLoc Exon Structure for
UBE2E3
ECgene alternative splicing isoforms for
UBE2E3

Expression for UBE2E3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for UBE2E3 Gene

Protein differential expression in normal tissues from HIPED for UBE2E3 Gene

This gene is overexpressed in Amniocyte (16.6), Fetal Brain (15.7), Testis (13.2), and Pancreas (12.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for UBE2E3 Gene



Protein tissue co-expression partners for UBE2E3 Gene

NURSA nuclear receptor signaling pathways regulating expression of UBE2E3 Gene:

UBE2E3

SOURCE GeneReport for Unigene cluster for UBE2E3 Gene:

Hs.470804

mRNA Expression by UniProt/SwissProt for UBE2E3 Gene:

Q969T4-UB2E3_HUMAN
Tissue specificity: Ubiquitously expressed at low levels. Highly expressed in skeletal muscle.

Evidence on tissue expression from TISSUES for UBE2E3 Gene

  • Nervous system(4.7)
  • Lung(4.5)
  • Liver(4.3)
  • Blood(4.2)
genes like me logo Genes that share expression patterns with UBE2E3: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for UBE2E3 Gene

Orthologs for UBE2E3 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for UBE2E3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia UBE2E3 34 35
  • 100 (n)
oppossum
(Monodelphis domestica)
Mammalia UBE2E3 35
  • 100 (a)
OneToOne
dog
(Canis familiaris)
Mammalia UBE2E3 34 35
  • 96.62 (n)
cow
(Bos Taurus)
Mammalia UBE2E3 34 35
  • 96.46 (n)
rat
(Rattus norvegicus)
Mammalia Ube2e3 34
  • 95.81 (n)
mouse
(Mus musculus)
Mammalia Ube2e3 34 16 35
  • 95.49 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia UBE2E3 35
  • 79 (a)
OneToOne
chicken
(Gallus gallus)
Aves UBE2E3 34 35
  • 90.82 (n)
lizard
(Anolis carolinensis)
Reptilia UBE2E3 35
  • 92 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ube2e3 34
  • 85.51 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.7787 34
zebrafish
(Danio rerio)
Actinopterygii ube2e3 34 35
  • 80.35 (n)
zgc55923 34
fruit fly
(Drosophila melanogaster)
Insecta UbcD2 36 35
  • 86 (a)
CG5440 36 35
  • 71 (a)
CG10862 36
  • 52 (a)
CG2574 36 35
  • 50 (a)
thale cress
(Arabidopsis thaliana)
eudicotyledons FUS9 34
  • 61.04 (n)
rice
(Oryza sativa)
Liliopsida Os07g0577400 34
  • 57.89 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.6406 35
  • 71 (a)
OneToMany
Species where no ortholog for UBE2E3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for UBE2E3 Gene

ENSEMBL:
Gene Tree for UBE2E3 (if available)
TreeFam:
Gene Tree for UBE2E3 (if available)

Paralogs for UBE2E3 Gene

genes like me logo Genes that share paralogs with UBE2E3: view

Variants for UBE2E3 Gene

Sequence variations from dbSNP and Humsavar for UBE2E3 Gene

SNP ID Clin Chr 02 pos Sequence Context AA Info Type
rs1000022494 -- 181,006,701(+) TTCTA(C/T)ATTTT intron-variant
rs1000039772 -- 180,981,653(+) AGTGA(C/T)TTTTA intron-variant, upstream-variant-2KB
rs1000066888 -- 180,994,881(+) TCAAA(A/C)CTTAC intron-variant
rs1000082645 -- 181,018,281(+) ATTCT(G/T)GTGAT intron-variant
rs1000097134 -- 181,024,028(+) CCAGT(A/G)CTCAT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for UBE2E3 Gene

Variant ID Type Subtype PubMed ID
dgv17e194 CNV deletion 18987734
dgv2103n106 CNV deletion 24896259
dgv2104n106 CNV deletion 24896259
esv2721202 CNV deletion 23290073
esv2721203 CNV deletion 23290073
esv3306526 CNV mobile element insertion 20981092
esv3379332 CNV insertion 20981092
esv3441935 CNV duplication 20981092
esv3560631 CNV deletion 23714750
esv3605 CNV loss 18987735
esv9135 CNV loss 19470904
nsv1072467 CNV deletion 25765185
nsv1072468 CNV deletion 25765185
nsv1123413 CNV deletion 24896259
nsv1136446 CNV deletion 24896259
nsv1145721 CNV deletion 26484159
nsv954440 CNV duplication 24416366
nsv954723 CNV deletion 24416366
nsv979154 CNV duplication 23825009

Variation tolerance for UBE2E3 Gene

Residual Variation Intolerance Score: 56.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.12; 2.80% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for UBE2E3 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
UBE2E3

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for UBE2E3 Gene

Disorders for UBE2E3 Gene

MalaCards: The human disease database

(1) MalaCards diseases for UBE2E3 Gene - From: Novoseek and GeneCards

Disorder Aliases PubMed IDs
parkinson disease, late-onset
  • parkinson disease
- elite association - COSMIC cancer census association via MalaCards

Relevant External Links for UBE2E3

Genetic Association Database (GAD)
UBE2E3
Human Genome Epidemiology (HuGE) Navigator
UBE2E3
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
UBE2E3
genes like me logo Genes that share disorders with UBE2E3: view

No data available for UniProtKB/Swiss-Prot and Genatlas for UBE2E3 Gene

Publications for UBE2E3 Gene

  1. cDNA cloning, characterization, and chromosome mapping of UBE2E3 (alias UbcH9), encoding an N-terminally extended human ubiquitin- conjugating enzyme. (PMID: 10343118) Ito K. … Okano Y. (Cytogenet. Cell Genet. 1999) 2 3 4 22 64
  2. Ubiquitin charging of human class III ubiquitin-conjugating enzymes triggers their nuclear import. (PMID: 15545318) Plafker S.M. … Macara I.G. (J. Cell Biol. 2004) 3 4 22 64
  3. The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines. (PMID: 20061386) David Y. … Navon A. (J. Biol. Chem. 2010) 3 4 64
  4. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  5. Multiple common variants for celiac disease influencing immune gene expression. (PMID: 20190752) Dubois P.C. … van Heel D.A. (Nat. Genet. 2010) 3 46 64

Products for UBE2E3 Gene

Sources for UBE2E3 Gene

Content
Loading form....