Free for academic non-profit institutions. Other users need a Commercial license

Aliases for UBE2E1 Gene

Aliases for UBE2E1 Gene

  • Ubiquitin Conjugating Enzyme E2 E1 2 3 5
  • Ubiquitin-Conjugating Enzyme E2E 1 (Homologous To Yeast UBC4/5) 2 3
  • Ubiquitin-Conjugating Enzyme E2E 1 (UBC4/5 Homolog, Yeast) 2 3
  • (E3-Independent) E2 Ubiquitin-Conjugating Enzyme E1 3 4
  • E2 Ubiquitin-Conjugating Enzyme E1 3 4
  • Ubiquitin Carrier Protein E1 3 4
  • Ubiquitin-Protein Ligase E1 3 4
  • UBCH6 3 4
  • Ubiquitin-Conjugating Enzyme E2E 1 2
  • Ubiquitin Conjugating Enzyme E2E 1 3
  • Ubiquitin-Conjugating Enzyme E2 E1 3
  • EC 6.3.2.19 61
  • EC 2.3.2.23 4
  • EC 2.3.2.24 4

External Ids for UBE2E1 Gene

Previous GeneCards Identifiers for UBE2E1 Gene

  • GC03M023441
  • GC03P023529
  • GC03P023697
  • GC03P023822
  • GC03P023793
  • GC03P023847

Summaries for UBE2E1 Gene

Entrez Gene Summary for UBE2E1 Gene

  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

GeneCards Summary for UBE2E1 Gene

UBE2E1 (Ubiquitin Conjugating Enzyme E2 E1) is a Protein Coding gene. Among its related pathways are APC-Cdc20 mediated degradation of Nek2A and Interferon gamma signaling. GO annotations related to this gene include ligase activity and acid-amino acid ligase activity. An important paralog of this gene is UBE2E2.

UniProtKB/Swiss-Prot for UBE2E1 Gene

  • Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes Lys-48-linked polyubiquitination.

Gene Wiki entry for UBE2E1 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for UBE2E1 Gene

Genomics for UBE2E1 Gene

Regulatory Elements for UBE2E1 Gene

Enhancers for UBE2E1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH03G023738 1.6 FANTOM5 Ensembl ENCODE 14.9 -65.4 -65388 3.5 PKNOX1 ZNF121 GATA2 FOS JUNB TBX21 MEF2D MAFF SMARCA4 MYNN UBE2E1 UBE2E1-AS1 NR1D2 GC03M023675
GH03G023648 1.4 Ensembl ENCODE dbSUPER 10.7 -155.8 -155846 2.8 INSM2 KLF17 RAD21 GATA2 SCRT2 FOS ETV6 CREM ZNF654 USF2 UBE2E1-AS1 UBE2E1 LOC105376993 GC03P023679
GH03G023829 1.1 Ensembl ENCODE 12.3 +24.0 23956 1.1 PKNOX1 TBL1XR1 BMI1 ZNF121 CBX5 RELB ETV6 IKZF2 CREM ZNF202 UBE2E1 UBE2E1-AS1 NKIRAS1 NR1D2 RPL15 GC03P023841
GH03G023864 1.2 Ensembl ENCODE 11.1 +59.9 59894 2.1 ATF1 TCF12 ZNF766 GATA2 JUNB TBX21 MEF2D SMARCA4 GLIS1 MYNN RPL15 NKIRAS1 UBE2E1 UBE2E1-AS1 NR1D2 GC03M023860 ARL4AP4
GH03G023876 1 Ensembl ENCODE 12.4 +71.6 71619 1.6 PKNOX1 SIN3A MAX ZFHX2 EGR1 POLR2A SMC3 RCOR1 PRDM10 CHD2 UBE2E1-AS1 UBE2E1 RPL15 NKIRAS1 NR1D2 ARL4AP4 GC03M023860
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around UBE2E1 on UCSC Golden Path with GeneCards custom track

Promoters for UBE2E1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000149748 607 2201 FOXA2 ZNF133 SIN3A FEZF1 ZNF2 ZNF48 YY1 GLIS2 ELK1 ZNF263

Genomic Location for UBE2E1 Gene

Chromosome:
3
Start:
23,805,893 bp from pter
End:
23,891,640 bp from pter
Size:
85,748 bases
Orientation:
Plus strand

Genomic View for UBE2E1 Gene

Genes around UBE2E1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
UBE2E1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for UBE2E1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for UBE2E1 Gene

Proteins for UBE2E1 Gene

  • Protein details for UBE2E1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P51965-UB2E1_HUMAN
    Recommended name:
    Ubiquitin-conjugating enzyme E2 E1
    Protein Accession:
    P51965
    Secondary Accessions:
    • B2RBX4
    • C9J8K2
    • K4DI90

    Protein attributes for UBE2E1 Gene

    Size:
    193 amino acids
    Molecular mass:
    21404 Da
    Quaternary structure:
    • Interacts with RNF14.

    Three dimensional structures from OCA and Proteopedia for UBE2E1 Gene

    Alternative splice isoforms for UBE2E1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for UBE2E1 Gene

Selected DME Specific Peptides for UBE2E1 Gene

P51965:
  • STILGPPGSVYEGGVFFLDI
  • YPFKPPK
  • SKVLLSICSLLTD
  • TNRAEHDR
  • ICLDILK
  • ITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVF

Post-translational modifications for UBE2E1 Gene

Antibody Products

  • Santa Cruz Biotechnology (SCBT) Antibodies for UBE2E1

Domains & Families for UBE2E1 Gene

Gene Families for UBE2E1 Gene

Suggested Antigen Peptide Sequences for UBE2E1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P51965

UniProtKB/Swiss-Prot:

UB2E1_HUMAN :
  • Belongs to the ubiquitin-conjugating enzyme family.
Family:
  • Belongs to the ubiquitin-conjugating enzyme family.
genes like me logo Genes that share domains with UBE2E1: view

Function for UBE2E1 Gene

Molecular function for UBE2E1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.
UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.
UniProtKB/Swiss-Prot Function:
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes Lys-48-linked polyubiquitination.

Enzyme Numbers (IUBMB) for UBE2E1 Gene

Gene Ontology (GO) - Molecular Function for UBE2E1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004842 ubiquitin-protein transferase activity TAS,IDA 16307923
GO:0005515 protein binding IPI 16307923
GO:0005524 ATP binding IEA --
GO:0016740 transferase activity IEA --
genes like me logo Genes that share ontologies with UBE2E1: view
genes like me logo Genes that share phenotypes with UBE2E1: view

Animal Model Products

CRISPR Products

miRNA for UBE2E1 Gene

miRTarBase miRNAs that target UBE2E1

Inhibitory RNA Products

Clone Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for UBE2E1 Gene

Localization for UBE2E1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for UBE2E1 Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for UBE2E1 gene
Compartment Confidence
nucleus 5
cytosol 5

Gene Ontology (GO) - Cellular Components for UBE2E1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000151 ubiquitin ligase complex IDA 15247280
GO:0005634 nucleus IEA,IDA 18845142
GO:0005654 nucleoplasm TAS --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with UBE2E1: view

Pathways & Interactions for UBE2E1 Gene

SuperPathways for UBE2E1 Gene

SuperPathway Contained pathways
1 CDK-mediated phosphorylation and removal of Cdc6
2 APC-Cdc20 mediated degradation of Nek2A
3 Protein ubiquitination
4 Class I MHC mediated antigen processing and presentation
5 Cell Cycle, Mitotic
.60
genes like me logo Genes that share pathways with UBE2E1: view

UniProtKB/Swiss-Prot P51965-UB2E1_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for UBE2E1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000209 protein polyubiquitination IDA 15247280
GO:0006511 ubiquitin-dependent protein catabolic process TAS 8576257
GO:0010390 histone monoubiquitination IDA 16307923
GO:0016567 protein ubiquitination TAS --
GO:0031145 anaphase-promoting complex-dependent catabolic process TAS --
genes like me logo Genes that share ontologies with UBE2E1: view

No data available for SIGNOR curated interactions for UBE2E1 Gene

Drugs & Compounds for UBE2E1 Gene

(4) Drugs for UBE2E1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved Nutra 0
Adenosine triphosphate Approved Nutra 0

(1) Additional Compounds for UBE2E1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
genes like me logo Genes that share compounds with UBE2E1: view

Transcripts for UBE2E1 Gene

Unigene Clusters for UBE2E1 Gene

Ubiquitin-conjugating enzyme E2E 1:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for UBE2E1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9a · 9b · 9c · 9d · 9e
SP1: - - - - - -
SP2: - - - - -
SP3: - - - -
SP4: - - -
SP5: - - - - - - -
SP6: - - - - - - -
SP7: - - - - -
SP8: - - -
SP9: - - -

Relevant External Links for UBE2E1 Gene

GeneLoc Exon Structure for
UBE2E1
ECgene alternative splicing isoforms for
UBE2E1

Expression for UBE2E1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for UBE2E1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for UBE2E1 Gene

This gene is overexpressed in Breast (45.4) and Peripheral blood mononuclear cells (10.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for UBE2E1 Gene



Protein tissue co-expression partners for UBE2E1 Gene

NURSA nuclear receptor signaling pathways regulating expression of UBE2E1 Gene:

UBE2E1

SOURCE GeneReport for Unigene cluster for UBE2E1 Gene:

Hs.164853

Evidence on tissue expression from TISSUES for UBE2E1 Gene

  • Nervous system(4.6)
  • Intestine(4.3)
  • Lymph node(2)
genes like me logo Genes that share expression patterns with UBE2E1: view

Primer Products

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for UBE2E1 Gene

Orthologs for UBE2E1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for UBE2E1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia UBE2E1 34 35
  • 100 (n)
dog
(Canis familiaris)
Mammalia UBE2E1 34 35
  • 97.06 (n)
cow
(Bos Taurus)
Mammalia UBE2E1 34
  • 92.75 (n)
rat
(Rattus norvegicus)
Mammalia Ube2e1 34
  • 91.54 (n)
mouse
(Mus musculus)
Mammalia Ube2e1 34 16 35
  • 91.02 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia UBE2E1 35
  • 91 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia UBE2E1 35
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves UBE2E1 34 35
  • 87.05 (n)
lizard
(Anolis carolinensis)
Reptilia UBE2E1 35
  • 99 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ube2e1 34
  • 83.13 (n)
MGC75971 34
zebrafish
(Danio rerio)
Actinopterygii ube2e2 35
  • 80 (a)
ManyToMany
ube2e1 34
  • 79.5 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.4084 34
fruit fly
(Drosophila melanogaster)
Insecta UbcD2 36 35
  • 87 (a)
CG5440 36 35
  • 70 (a)
CG10862 36
  • 51 (a)
CG2574 36 35
  • 47 (a)
soybean
(Glycine max)
eudicotyledons Gma.1978 34
sea squirt
(Ciona savignyi)
Ascidiacea CSA.6406 35
  • 71 (a)
OneToMany
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.6467 34
Species where no ortholog for UBE2E1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for UBE2E1 Gene

ENSEMBL:
Gene Tree for UBE2E1 (if available)
TreeFam:
Gene Tree for UBE2E1 (if available)

Paralogs for UBE2E1 Gene

genes like me logo Genes that share paralogs with UBE2E1: view

Variants for UBE2E1 Gene

Sequence variations from dbSNP and Humsavar for UBE2E1 Gene

SNP ID Clin Chr 03 pos Sequence Context AA Info Type
rs1000060375 -- 23,887,039(+) TACTT(-/A)ACCAT intron-variant
rs1000060469 -- 23,865,727(+) CTGTT(C/T)GAATC intron-variant
rs1000107442 -- 23,819,201(+) ATCGC(C/T)TGAAC intron-variant
rs1000142358 -- 23,872,288(+) GAATC(A/T)GGCAG intron-variant
rs1000173893 -- 23,872,487(+) ATTAC(A/G)CCAAA intron-variant

Structural Variations from Database of Genomic Variants (DGV) for UBE2E1 Gene

Variant ID Type Subtype PubMed ID
esv3378355 CNV insertion 20981092
esv3561606 CNV deletion 23714750
esv3575556 CNV gain 25503493
esv3595568 CNV loss 21293372
nsv1005186 CNV gain 25217958
nsv834637 CNV loss 17160897
nsv954452 CNV duplication 24416366

Variation tolerance for UBE2E1 Gene

Residual Variation Intolerance Score: 42.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.39; 54.17% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for UBE2E1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
UBE2E1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for UBE2E1 Gene

Disorders for UBE2E1 Gene

Relevant External Links for UBE2E1

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
UBE2E1

No disorders were found for UBE2E1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for UBE2E1 Gene

Publications for UBE2E1 Gene

  1. Cloning of human ubiquitin-conjugating enzymes UbcH6 and UbcH7 (E2- F1) and characterization of their interaction with E6-AP and RSP5. (PMID: 8576257) Nuber U. … Scheffner M. (J. Biol. Chem. 1996) 2 3 4 64
  2. The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines. (PMID: 20061386) David Y. … Navon A. (J. Biol. Chem. 2010) 3 4 64
  3. The autoantigen Ro52 is an E3 ligase resident in the cytoplasm but enters the nucleus upon cellular exposure to nitric oxide. (PMID: 18845142) Espinosa A. … Wahren-Herlenius M. (Exp. Cell Res. 2008) 3 4 64
  4. E3-independent monoubiquitination of ubiquitin-binding proteins. (PMID: 17588522) Hoeller D. … Dikic I. (Mol. Cell 2007) 3 4 64
  5. Link between the ubiquitin conjugation system and the ISG15 conjugation system: ISG15 conjugation to the UbcH6 ubiquitin E2 enzyme. (PMID: 16428300) Takeuchi T. … Yokosawa H. (J. Biochem. 2005) 3 4 64

Products for UBE2E1 Gene

Sources for UBE2E1 Gene

Content
Loading form....