Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

UBE2C Gene

protein-coding   GIFtS: 66
GCID: GC20P044442

ubiquitin-conjugating enzyme E2C

 Explore 18 diseases affiliated with
UBE2C via our new
 Human Malady Compendium 
Biological research products
for UBE2C
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Ubiquitin-Conjugating Enzyme E2C1 2     DJ447F3.21
UBCH101 2 3 5     Mitotic-Specific Ubiquitin-Conjugating Enzyme2
Ubiquitin Carrier Protein C2 3     Ubiquitin Carrier Protein E2-C2
Ubiquitin-Protein Ligase C2 3     Ubiquitin-Conjugating Enzyme E2 C2
EC 6.3.2.193 8     UbcH103
Cyclin-Selective Ubiquitin Carrier Protein2     

External Ids:    HGNC: 159371   Entrez Gene: 110652   Ensembl: ENSG000001750637   OMIM: 6055745   UniProtKB: O007623   

Export aliases for UBE2C gene to outside databases

Previous GC identifers: GC20P044169 GC20P045079 GC20P045126 GC20P043874 GC20P041183


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for UBE2C:
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived
proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or
E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the
E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell
cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. (provided
by RefSeq, Feb 2009)

UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762
Function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro
catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting
complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by
initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by
the proteasome and promoting mitotic exit

Gene Wiki entry for UBE2C


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000020.10  NC_018931.1  NT_011362.10  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the UBE2C gene promoter:
         c-Rel   Pax-2   CP1A   CP1C   Pax-2a   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): UBE2C promoter sequence
   Search SABiosciences Chromatin IP Primers for UBE2C

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat UBE2C


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 20q13.12   Ensembl cytogenetic band:  20q13.12   HGNC cytogenetic band: 20q13.12

UBE2C Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
UBE2C gene location

GeneLoc information about chromosome 20         GeneLoc Exon Structure

GeneLoc location for GC20P044442:  view genomic region     (about GC identifiers)

Start:
44,441,215 bp from pter      End:
44,445,596 bp from pter
Size:
4,382 bases      Orientation:
plus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762 (See protein sequence)
Recommended Name: Ubiquitin-conjugating enzyme E2 C  
Size: 179 amino acids; 19652 Da
Subunit: Component of the APC/C complex
1 PDB 3D structure from and Proteopedia for UBE2C:
1I7K (3D)    
Secondary accessions: A6NP33 E1P5N7 G3XAB7
Alternative splicing: 4 isoforms:  O00762-1   O00762-2   O00762-3   O00762-4   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for UBE2C: NX_O00762

Post-translational modifications:

  • Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a central
  • role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit the
    autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates have
    been destroyed1
  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_O00762

  • 4 DME Specific Peptides for UBE2C (O00762)
     ICLDILK  QSLLGEPN  GTVYEDLRYKLSLEFPSGYPYNAPTVKF  VGKRLQQELMTLMMSGDKGISAFPESDNLFKW 

    UBE2C Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins (6 alternative transcripts): 
    NP_008950.1  NP_861515.1  NP_861516.1  NP_861517.1  NP_861518.1  NP_861519.1  

    ENSEMBL proteins: 
     ENSP00000348838   ENSP00000335674   ENSP00000243893   ENSP00000333975   ENSP00000361649  
     ENSP00000385878  
    Reactome Protein details: O00762
    Human Recombinant Protein Products: 
    EMD Millipore Purified and/or Recombinant UBE2C Protein
    R&D Systems Recombinant & Natural Proteins for UBE2C (UbcH10/UBE2C)
    Enzo Life Sciences proteins for UBE2C
    OriGene Purified Proteins (see all 3): UBE2C
    OriGene Protein Over-expression Lysate (see all 3): UBE2C
    OriGene Custom Protein Services for UBE2C 
    GenScript Purified and Recombinant Proteins for UBE2C
    Novus Biologicals UBE2C Proteins
    Novus Biologicals UBE2C Lysates
    Browse Sino Biological Recombinant Proteins
    ProSpec Recombinant Protein for UBE2C
    Uscn Proteins for UBE2C

    Gene Ontology (GO): 3 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005654nucleoplasm TAS--
    GO:0005680anaphase-promoting complex IDA19822757
    GO:0005829cytosol TAS--


    UBE2C for ontologies           About GeneDecksing



    UBE2C Antibody Products: 
    EMD Millipore Mono- and Polyclonal Antibodies for the study of UBE2C
    R&D Systems Antibodies for UBE2C (UbcH10/UBE2C)
    OriGene Antibodies: UBE2C
    OriGene Custom Antibody Services for UBE2C 
    GenScript Custom Superior Antibodies Services for UBE2C
    Novus Biologicals UBE2C Antibodies
    Abcam antibodies for UBE2C 
    Uscn Antibodies for UBE2C
    ThermoFisher Antibodies for UBE2C

    Assay Products for UBE2C: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for UBE2C
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for UBE2C


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    UBE2C for domains           About GeneDecksing

    3 InterPro domains/families:
     IPR016135 UBQ-conjugating_enzyme/RWD
     IPR023313 UBQ-conjugating_AS
     IPR000608 UBQ-conjugat_E2

    Graphical View of Domain Structure for InterPro Entry O00762

    ProtoNet protein and cluster: O00762

    1 Blocks protein family: IPB000608 Ubiquitin-conjugating enzymes

    UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762
    Similarity: Belongs to the ubiquitin-conjugating enzyme family


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762
    Function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro
    catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting
    complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by
    initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by
    the proteasome and promoting mitotic exit
    Catalytic activity: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine

    Enzyme Number (IUBMB): EC 6.3.2.191 2

    miRNA
    Products:
        
    OriGene 3'-UTR Clone (see all 5): UBE2C
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat UBE2C
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate UBE2C
    SwitchGear 3'UTR luciferase reporter plasmidUBE2C 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for UBE2C (see all 7)
    OriGene shRNA RFP: UBE2C
    OriGene siRNA: UBE2C
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat UBE2C

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for UBE2C

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2C (see all 8)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2C (see all 7)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 6): UBE2C (NM_007019)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2C
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2C 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for UBE2C
    Search LifeMap BioReagents cell lines for UBE2C

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2C

    Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004842contributes to ubiquitin-protein ligase activity IDA19822757
    GO:0005515protein binding IPI19822757
    GO:0005524ATP binding IEA--
    GO:0016881acid-amino acid ligase activity ----


    UBE2C for ontologies           About GeneDecksing


    3 GenomeRNAi human phenotypes for UBE2C:
     Decreased cilium length after   Decreased viability  Upregulation of Wnt/beta-caten 


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/9 super-pathways (see all 9About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Ubiquitinated Orc1 is degraded by the proteasome
    8/15 pathways (see all 15)
    APC/C:Cdh1-mediated degradation of Skp20.74
    APC/C:Cdc20 mediated degradation of mitotic proteins0.69
    APC/C:Cdc20 mediated degradation of Securin0.74
    APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G10.69
    Degradation of multiubiquitinated Securin0.74
    Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins0.68
    Autodegradation of Cdh1 by Cdh1:APC/C0.70
    Regulation of APC/C activators between G1/S and early anaphase0.62
    2APC-Cdc20 mediated degradation of Nek2A
    8/10 pathways (see all 10)
    Degradation of multiubiquitinated Nek2A1.00
    Degradation of multiubiquitinated Cyclin B0.76
    APC-Cdc20 mediated degradation of Nek2A1.00
    Mitotic Spindle Checkpoint0.75
    Inactivation of APC/C via direct inhibition of the APC/C complex0.78
    Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase0.60
    Inhibition of the proteolytic activity of APC/C required for the onset of anaphase by mitotic spindle checkpoint components0.78
    Phosphorylation of the APC/C0.54
    3M Phase
    M Phase1.00
    Mitotic Anaphase0.85
    Mitotic M-M/G1 phases0.88
    Separation of Sister Chromatids0.80
    Mitotic Metaphase and Anaphase0.85
    4Antigen processing: Ubiquitination & Proteasome degradation
    Antigen processing: Ubiquitination & Proteasome degradation1.00
    Polyubiquitination of substrate0.75
    Class I MHC mediated antigen processing & presentation0.83
    Ubiquitin mediated proteolysis0.36
    5Immune System
    Immune System1.00
    Adaptive Immune System0.59

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    1 EMD Millipore Pathway for UBE2C
        Common schema of ubiquitination

    3 Downloadable PowerPoint Slides of QIAGEN Pathway Central Maps for UBE2C
        Ubiquitin-Proteasome Dependent Proteolysis
    Remodeling of Adherens Junctions
    SOCS Pathway

    5/36        Reactome Pathways for UBE2C (see all 36)
        APC/C:Cdc20 mediated degradation of mitotic proteins
    Phosphorylation of the APC/C
    APC/C:Cdc20 mediated degradation of Securin
    Cdc20:Phospho-APC/C mediated degradation of Cyclin A
    Antigen processing: Ubiquitination & Proteasome degradation


    1         Kegg Pathway  (Kegg details for UBE2C):
        Ubiquitin mediated proteolysis

    UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762
    Pathway: Protein modification; protein ubiquitination


    UBE2C for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for UBE2C

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/105 Interacting proteins for UBE2C (O007623 ENSP000003488384) via UniProtKB, MINT, STRING, and/or I2D (see all 105)

    InteractantInteraction Details
    GeneCardExternal ID(s)
    ANAPC11Q9NYG53, ENSP000003499574I2D: score=1 STRING: ENSP00000349957
    PCGF3Q3KNV83, ENSP000003547244I2D: score=1 STRING: ENSP00000354724
    POLMQ9NP873, ENSP000002422484I2D: score=1 STRING: ENSP00000242248
    RANBP9Q96S593, ENSP000000116194I2D: score=1 STRING: ENSP00000011619
    UBASH3BQ8TF423, ENSP000002842734I2D: score=1 STRING: ENSP00000284273
    About this table

    Gene Ontology (GO): 5/21 biological process terms (GO ID links to tree view) (see all 21):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000075cell cycle checkpoint TAS--
    GO:0000278mitotic cell cycle TAS--
    GO:0006511ubiquitin-dependent protein catabolic process IDA18485873
    GO:0007049cell cycle NAS15504738
    GO:0007051spindle organization NAS15504738


    UBE2C for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    UBE2C for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for UBE2C

    4 HMDB Compounds for UBE2C    About this table
    CompoundSynonyms CAS #PubMed Ids
    Adenosine monophosphate5'-AMP (see all 28)61-19-8--
    Adenosine triphosphate5'-(tetrahydrogen triphosphate) Adenosine (see all 24)56-65-5--
    Phosphoric acidacide phosphorique (FRENCH) (see all 20)7664-38-2--
    Pyrophosphate(4-)Diphosphoric acid ion (see all 10)14000-31-8--
    2 Novoseek chemical compound relationships for UBE2C gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    lysine 19.1 1 14732013 (1)
    oligonucleotide 11.8 1 17217624 (1)

    Search CenterWatch for drugs/clinical trials and news about UBE2C 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for UBE2C gene (6 alternative transcripts): 
    NM_007019.2  NM_181799.1  NM_181800.1  NM_181801.2  NM_181802.1  NM_181803.1  

    Unigene Cluster for UBE2C:

    Ubiquitin-conjugating enzyme E2C
    Hs.93002  [show with all ESTs]
    Unigene Representative Sequence: BC032677
    7 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000356455(uc002xpm.3 uc002xpo.3 uc002xpp.3) ENST00000335046(uc002xpl.3)
    ENST00000243893 ENST00000352551 ENST00000372568(uc002xpq.3) ENST00000496085
    ENST00000405520(uc002xpn.3)

    miRNA
    Products:
         
    OriGene 3'-UTR Clone (see all 5): UBE2C
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat UBE2C
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate UBE2C
    SwitchGear 3'UTR luciferase reporter plasmidUBE2C 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for UBE2C (see all 7)
    OriGene shRNA RFP: UBE2C
    OriGene siRNA: UBE2C
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat UBE2C
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2C (see all 8)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2C (see all 7)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 6): UBE2C (NM_007019)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2C
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2C 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for UBE2C
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat UBE2C
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat UBE2C
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat UBE2C

    Additional cDNA sequence: 

    AK311949.1 BC007656.2 BC016292.1 BC028161.1 BC032677.2 BC050736.1 BT007300.1 BT020165.1 
    BT020166.1 CR456988.1 U73379.1 

    17 DOTS entries:

    DT.455083  DT.446076  DT.101984847  DT.91766689  DT.95092516  DT.101984846  DT.100822418  DT.120817240 
    DT.120817711  DT.102842123  DT.102842126  DT.120817606  DT.102842114  DT.120817859  DT.95189185  DT.95245584 
    DT.100038110 

    24/252 AceView cDNA sequences (see all 252):

    AA596035 BU727867 AW016092 CK904708 NM_181802 BC007656 BM755952 NM_181800 
    BC016292 BC028161 BM467729 BI870709 AA315182 BE905692 BU844974 BU506804 
    BE268039 BM423477 BU625723 AI264541 BM845270 NM_181799 BM758823 CR610834 

    GeneLoc Exon Structure

    5/8 Alternative Splicing Database (ASD) splice patterns (SP) for UBE2C (see all 8)    About this scheme

    ExUns: 1a · 1b ^ 2a · 2b ^ 3a · 3b ^ 4a · 4b ^ 5 ^ 6a · 6b
    SP1:                    -     -           -                           
    SP2:                    -     -                 -                     
    SP3:                    -     -           -     -                     
    SP4:                    -     -     -           -                     
    SP5:                    -     -     -     -                           


    ECgene alternative splicing isoforms for UBE2C

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    UBE2C expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: CTGCCGAGCT

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image

    UBE2C expression in embryonic tissues and stem cells
    Expression by the Database of Embryonic development, Stem cell research, and Regenerative medicine    About this table
    Stem Cell Differentiation: 2 LifeMap Cells 
    NameCategory
    PureStem™ progenitor E44 (Embryonic Progenitor Cell)
    PureStem™ progenitor F15 (Embryonic Progenitor Cell)
    Expression: Positive    Negative     Selective marker
    Experimental details: Curated     Microarrays     In-situ hybridization

    See UBE2C Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for UBE2C

    SOURCE GeneReport for Unigene cluster: Hs.93002
        SABiosciences Expression via Pathway-Focused PCR Array including UBE2C: 
              Ubiquitination (Ubiquitylation) Pathway in human mouse rat

    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for UBE2C
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat UBE2C
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat UBE2C
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat UBE2C
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2C

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of eukaryotes.

    Orthologs for UBE2C gene from 7/30 species (see all 30)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    chicken
    (Gallus gallus)
    Aves LOC1008594131 ubiquitin-conjugating enzyme E2 C-like 78.41(n)
    88.57(a)
      100859413  XM_003642470.1  XP_003642518.1 
    African clawed frog
    (Xenopus laevis)
    Amphibia 480179322   -- 77.83(n)    48017932 
    zebrafish
    (Danio rerio)
    Actinopterygii ube2c1 ubiquitin-conjugating enzyme E2C 68.64(n)
    76.92(a)
      566441  NM_001037691.1  NP_001032780.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta vihar3
    vih1
    ubiquitin conjugating enzyme3
    vihar1
    66(a)3
    65.13(n)1
    66.45(a)1
      69C43
    441181  NM_140325.21  NP_648582.11 
    baker's yeast
    (Saccharomyces cerevisiae)
    Saccharomycetes UBC11(YOR339C)4
    UBC111
    Ubiquitin-conjugating enzyme most similar in sequence to Xenopus ubiquitin-conjugating enzyme E2-C, but not a true functional homolog of this E2; unlike E2-C, not required for the degradation of mitotic cyclin Clb2 less4
    Ubc11p1
    56.25(n)1
    63.28(a)1
      15(958832-958362)4
    8545171, 4  NP_014984.31  NP_014984.14 
    thale cress
    (Arabidopsis thaliana)
    eudicotyledons UBC191 ubiquitin-conjugating enzyme E2 19 58.9(n)
    59.51(a)
      821545  NM_112897.3  NP_566653.1 
    rice
    (Oryza sativa)
    Liliopsida Os.2472 Oryza sativa (japonica cultivar-group) cDNA clone001-117-G01, full insert sequence less 75.21(n)    AK105320.1 


    ENSEMBL Gene Tree for UBE2C (if available)
    TreeFam Gene Tree for UBE2C (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for UBE2C gene
    UBE2U2  
    18/22 SIMAP similar genes for UBE2C using alignment to 3 protein entries:     UBE2C_HUMAN (see all proteins) (see all similar genes):
    HR6A    UBE2A    UBE2U    UBE2B    UBE2H    UBE2D4
    UBE2K    UBE2N    UBE2D3    UBE2D2    UBE2D1    UBE2S
    UBE2M    UBE2E1    UBE2NL    UBE2W    UBE2T    UBE2E3

    UBE2C for paralogs           About GeneDecksing


    5 Pseudogenes.org Pseudogenes for UBE2C
    PGOHUM00000247755 PGOHUM00000247067 PGOHUM00000234895 PGOHUM00000250630 PGOHUM00000245919


    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/157 NCBI SNPs in UBE2C are shown (see all 157    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 20 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs169907931,2
    C,F,--44439345(+) TAAAAG/TATTGT 6 -- us2k1 int15Minor allele frequency- T:0.06NA WA 256
    rs1920397561,2
    --44439392(+) TCCGTA/GCTAAA 6 -- int1 us2k10--------
    rs126244281,2
    C,H,--44439393(+) CCGTAA/C/TTAAAT 6 -- us2k1 int14NS EA 404
    rs799311121,2
    --44439464(+) GAAGTG/ATTACT 6 -- us2k1 int11Minor allele frequency- A:0.01WA 118
    rs562610481,2
    C,F,--44439646(+) AGGCAG/CGGCCT 6 -- us2k1 int14Minor allele frequency- C:0.07NA WA EU 1563
    rs1166536361,2
    C,F,--44439654(+) CCTACA/CTCCTC 6 -- int1 us2k11Minor allele frequency- C:0.02WA 118
    rs2004592841,2
    --44439877(+) AAAGCC/TCTCTT 7 -- ut31 us2k10--------
    rs61043531,2
    C,H--44439897(+) GCTGAG/AGCCAC 7 -- us2k1 ut313Minor allele frequency- A:0.01NS NA 180
    rs1880295271,2
    --44439923(+) TAGATC/GGATCT 7 -- us2k1 ut310--------
    rs1405825521,2
    --44440048(+) TTTGTA/CGTAAA 7 -- ut31 us2k10--------

    HapMap Linkage Disequilibrium report for UBE2C (44441215 - 44445596 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for UBE2C: --

    SABiosciences Cancer Mutation PCR Assays
    1 SABiosciences qBiomarker Copy Number PCR Array containing UBE2C:
    Ovarian Cancer
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing UBE2C
    DNA2.0 Custom Variant and Variant Library Synthesis for UBE2C

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    UBE2C for disorders           About GeneDecksing

    OMIM gene information: 605574    OMIM disorders: --

    18 diseases for UBE2C:    About MalaCards
    papillary thyroid carcinoma    intrahepatic cholangiocarcinoma    gallbladder carcinoma    thyroid carcinoma
    cholangiocarcinoma    thyroiditis    hepatocellular carcinoma    cervical cancer
    cervicitis    colon cancer    carcinoma    colorectal cancer
    lung cancer    prostate cancer    esophagitis    neuroblastoma
    prostatitis    adenocarcinoma

    3 Novoseek disease relationships for UBE2C gene    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    primary tumor 15.8 2 16772118 (1)
    tumors 6.27 15 20065091 (4), 20099376 (4), 18331723 (1), 17217624 (1) (see all 6)
    metastasis 0 1 16772118 (1)

    Human Genome Epidemiology (HuGE) Navigator: UBE2C (3 documents)

    Export disorders for UBE2C gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for UBE2C gene, integrated from 9 sources (see all 113):
    (articles sorted by number of sources associating them with UBE2C)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Dominant-negative cyclin-selective ubiquitin carrier protein E2- C/UbcH10 blocks cells in metaphase. (PubMed id 9122200)1, 2, 3, 9 Townsley F.M.... Ruderman J.V. (1997)
    2. Identification of a physiological E2 module for the human anaphase- promoting complex. (PubMed id 19822757)1, 2 Williamson A....Rape M. (2009)
    3. UBE2S elongates ubiquitin chains on APC/C substrates to promote mitotic exit. (PubMed id 19820702)1, 2 Garnett M.J.... Venkitaraman A.R. (2009)
    4. Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex. (PubMed id 18485873)1, 2 Jin L....Rape M. (2008)
    5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    6. Structural and functional analysis of the human mitotic-specific ubiquitin-conjugating enzyme, UbcH10. (PubMed id 11927573)1, 2 Lin Y.... Basavappa R. (2002)
    7. The DNA sequence and comparative analysis of human chromosome 20. (PubMed id 11780052)1, 2 Deloukas P....Rogers J. (2001)
    8. Identification of overexpressed genes in hepatocellular carcinoma, with special reference to ubiquitin-conjugating enzyme E2C gene expression. (PubMed id 17354233)1, 9 Ieta K....Mori M. (2007)
    9. Expression and effect of inhibition of the ubiquitin-conjugating enzyme E2C on esophageal adenocarcinoma. (PubMed id 17217624)1, 9 Lin J....Lin L. (2006)
    10. Detection of aberrations of ubiquitin-conjugating enzyme E2C gene (UBE2C) in advanced colon cancer with liver metastases by DNA microarray and two-color FISH. (PubMed id 16772118)1, 9 Takahashi Y....Asai S. (2006)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 11065 HGNC: 15937 AceView: UBE2C Ensembl:ENSG00000175063 euGenes: HUgn11065
    ECgene: UBE2C Kegg: 11065 H-InvDB: UBE2C

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for UBE2C Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for UBE2C Genetics and Cytogenetics in Oncology and Haematology

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for UBE2C gene:
    Search GeneIP for patents involving UBE2C

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     EMD Millipore Purified and/or Recombinant UBE2C Protein
     Browse for Gene Knock-down Tools from EMD Millipore
     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     Browse Small Molecules at EMD Millipore
     Browse Kits and Assays available from EMD Millipore
     EMD Millipore Mono- and Polyclonal Antibodies for the study of UBE2C
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Antibodies for UBE2C (UbcH10/UBE2C)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Recombinant/Natural Proteins for UBE2C (UbcH10/UBE2C)  
     OriGene Antibodies for UBE2C   OriGene shRNA RFP for UBE2C  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for UBE2C   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for UBE2C  
     OriGene Protein Over-expression Lysate for UBE2C   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for UBE2C   OriGene 3'-UTR Clone for UBE2C  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2C   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for UBE2C  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     OriGene Purified Protein for UBE2C   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for UBE2C   OriGene Custom Protein Services for UBE2C  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat UBE2C
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing UBE2C
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat UBE2C
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat UBE2C
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat UBE2C
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat UBE2C
     GenScript Purified and Recombinant Proteins for UBE2C GenScript cDNA clones with any tag delivered in your preferred vector for UBE2C
     GenScript Custom Assay Services for UBE2C GenScript Custom Superior Antibodies Services for UBE2C
     GenScript Custom overexpressing Cell Line Services for UBE2C CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in UBE2C promoter
     Search Chromatin IP Primers for UBE2C
     RT2 qPCR Primer Assay in human, mouse, rat UBE2C
     GNC Network for UBE2C
     SABiosciences PCR Arrays including human, mouse, rat UBE2C
     Search Tocris compounds for UBE2C
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Proteins for UBE2C
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     UBE2C antibodies
     UBE2C proteins
     UBE2C lysates
     Antibodies for UBE2C
     See all of Abcam's Antibodies, Kits and Proteins for UBE2C
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for UBE2C




     UBE2C Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for UBE2C
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2C
     SwitchGear 3'UTR luciferase reporter plasmids for UBE2C
     SwitchGear Promoter luciferase reporter plasmids for UBE2C
     ThermoFisher Antibodies for UBE2C
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2C
           
    GeneCards Homepage - Last full update: 19 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 27 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      UBE2C gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4