Aliases for UBE2C Gene
Aliases for UBE2C Gene
- Ubiquitin Conjugating Enzyme E2 C 2 3 5
- (E3-Independent) E2 Ubiquitin-Conjugating Enzyme C 3 4
- E2 Ubiquitin-Conjugating Enzyme C 3 4
- Ubiquitin-Protein Ligase C 3 4
- UBCH10 3 4
- Mitotic-Specific Ubiquitin-Conjugating Enzyme 3
- Cyclin-Selective Ubiquitin Carrier Protein 3
- Ubiquitin-Conjugating Enzyme E2 C 3
External Ids for UBE2C Gene
- HGNC: 15937
- Entrez Gene: 11065
- Ensembl: ENSG00000175063
- OMIM: 605574
- UniProtKB: O00762
Previous GeneCards Identifiers for UBE2C Gene
- GC20P044169
- GC20P045079
- GC20P045126
- GC20P043874
- GC20P044442
- GC20P041183
Summaries for UBE2C Gene
-
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013]
GeneCards Summary for UBE2C Gene
UBE2C (Ubiquitin Conjugating Enzyme E2 C) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Innate Immune System. Gene Ontology (GO) annotations related to this gene include ligase activity and ubiquitin protein ligase binding. An important paralog of this gene is UBE2U.
UniProtKB/Swiss-Prot for UBE2C Gene
-
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-11- and Lys-48-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating Lys-11-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for UBE2C Gene
Genomics for UBE2C Gene
GeneHancer (GH) Regulatory Elements for UBE2C Gene
Regulatory Element Products
Genomic Locations for UBE2C Gene
- chr20:45,812,576-45,816,957
- (GRCh38/hg38)
- Size:
- 4,382 bases
- Orientation:
- Plus strand
- chr20:44,441,215-44,445,596
- (GRCh37/hg19)
Genomic View for UBE2C Gene
- Cytogenetic band:
-
- 20q13.12 by Ensembl
- 20q13.12 by Entrez Gene
- 20q13.12 by HGNC


RefSeq DNA sequence for UBE2C Gene
Proteins for UBE2C Gene
-
Protein details for UBE2C Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O00762-UBE2C_HUMAN
- Recommended name:
- Ubiquitin-conjugating enzyme E2 C
- Protein Accession:
- O00762
- A6NP33
- E1P5N7
- G3XAB7
Protein attributes for UBE2C Gene
- Size:
- 179 amino acids
- Molecular mass:
- 19652 Da
- Quaternary structure:
-
- Component of the APC/C complex, composed of at least 14 distinct subunits that assemble into a complex of at least 19 chains with a combined molecular mass of around 1.2 MDa. Within this complex, directly interacts with ANAPC2.
Three dimensional structures from OCA and Proteopedia for UBE2C Gene
Protein Expression for UBE2C Gene
Selected DME Specific Peptides for UBE2C Gene
- O00762:
-
- VGKRLQQELMTLMMSGDKGISAFPESDNLFKW
- QSLLGEPN
- ICLDILK
- GTVYEDLRYKLSLEFPSGYPYNAPTVKF
Post-translational modifications for UBE2C Gene
- Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates have been destroyed.
- Ubiquitination at isoforms=2, 380 and posLast=121121
Other Protein References for UBE2C Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Cell Signaling Technology (CST) Antibodies for UBE2C (UBE2C)
-
Custom Antibody ServicesOriGene Antibodies for UBE2C
- Novus Biologicals Antibodies for UBE2C
-
Abcam antibodies for UBE2C
-
Cloud-Clone Corp. Antibodies for UBE2C
- Invitrogen Antibodies for UBE2C
- GeneTex UBE2C antibody for UBE2C
-
Santa Cruz Biotechnology (SCBT) Antibodies for UBE2C
Protein Products
- R&D Systems Proteins and Enzymes for UBE2C (UbcH10/UBE2C)
- Search Origene for MassSpec and Protein Over-expression Lysates for UBE2C
- Origene Custom Protein Services for UBE2C
- ProSpec Recombinant Proteins for UBE2C
-
Cloud-Clone Corp. Proteins for UBE2C
- Search GeneTex for Proteins for UBE2C
-
ProSci Proteins for UBE2C
-
Abcam proteins for UBE2C
Assay Products
-
Cloud-Clone Corp. Assay Kits for UBE2C
- antibodies-online: Search results for 11 available UBE2C Elisa Kits ranked by validation data
- Compare Top UBE2C Elisa Kits
-
Quality Products:
Domains & Families for UBE2C Gene
Gene Families for UBE2C Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Cancer-related genes
- Enzymes
- Predicted intracellular proteins
Protein Domains for UBE2C Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for UBE2C Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
O00762- Family:
-
- Belongs to the ubiquitin-conjugating enzyme family.
Function for UBE2C Gene
Molecular function for UBE2C Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.
- UniProtKB/Swiss-Prot CatalyticActivity:
- S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.
- UniProtKB/Swiss-Prot Function:
- Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-11- and Lys-48-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating Lys-11-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
Enzyme Numbers (IUBMB) for UBE2C Gene
Phenotypes From GWAS Catalog for UBE2C Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000166 | nucleotide binding | IEA | -- |
GO:0004842 | contributes_to ubiquitin-protein transferase activity | IDA | 18485873 |
GO:0005515 | protein binding | IPI | 19822757 |
GO:0005524 | ATP binding | IEA | -- |
GO:0016740 | transferase activity | IEA | -- |
Phenotypes for UBE2C Gene
- MGI mutant phenotypes for UBE2C:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for UBE2C:
-
- Increased vaccinia virus (VACV) infection
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased NF-kappaB reporter expression
- Decreased IL-8 secretion
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Increased viability with TRAIL
- Upregulation of Wnt/beta-catenin pathway after WNT3A stimulation
- Increased cilium length after serum starvation
- Decreased HIV-1 infection
Animal Models for UBE2C Gene
- MGI Knock Outs for UBE2C:
-
- Ube2c tm1.1(KOMP)Wtsi
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for UBE2C
-
-
ViGene Biosciences ready-to-package AAV shRNAs for UBE2C gene
- Search ViGene Biosciences for UBE2C
CRISPR Products
-
OriGene CRISPR knockouts for UBE2C
- genomics-online: gRNA clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
- Applied Biological Materials CRISPR for UBE2C
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for UBE2C
- GenScript: Design CRISPR guide RNA sequences for UBE2C
miRNA for UBE2C Gene
- miRTarBase miRNAs that target UBE2C
miRNA Products
- Search ViGene Biosciences for UBE2C
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for UBE2C
- Browse OriGene Inhibitory RNA Products For UBE2C
- genomics-online: shRNA clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for UBE2C gene
Clone Products
-
OriGene ORF clones in human for UBE2C
- RC208741
- RC208741L1
- RC208741L2
- RG219935
- RC219935L2
- RC219935L1
- RC219935
- RG200240
- RC200240L2
- RC200240L1
- RC200240
- RG212654
- RC212654L2
- RC212654L1
- RC212654
- RG222316
- RC222316L2
- RC222316L1
- RC222316
- RG208741
- RC235499
- RC235917
- RC219935L2V
- RC219935L1V
- RC200240L2V
- RC200240L1V
- RC212654L2V
- RC212654L1V
- RC222316L2V
- RC222316L1V
- RC208741L2V
- RC208741L1V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for UBE2C
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for UBE2C
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for UBE2C
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for UBE2C
- Applied Biological Materials Clones for UBE2C
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for UBE2C
-
ViGene Biosciences ready-to-package AAV shRNAs for UBE2C gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for UBE2C Gene
Localization for UBE2C Gene
- Cytosol (4)
- Plasma membrane (4)
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000151 | ubiquitin ligase complex | IDA | 15749827 |
GO:0005654 | nucleoplasm | TAS | -- |
GO:0005680 | anaphase-promoting complex | IDA | 18485873 |
GO:0005737 | cytoplasm | IBA | -- |
GO:0005829 | cytosol | TAS | -- |
No data available for Subcellular locations from UniProtKB/Swiss-Prot for UBE2C Gene
Pathways & Interactions for UBE2C Gene
SuperPathway | Contained pathways | ||
---|---|---|---|
1 | CDK-mediated phosphorylation and removal of Cdc6 | ||
2 | APC-Cdc20 mediated degradation of Nek2A | ||
3 | Protein ubiquitination | ||
4 | Class I MHC mediated antigen processing and presentation | ||
5 | Cell Cycle, Mitotic |
.83
|
.60
|
Pathways by source for UBE2C Gene
1 Cell Signaling Technology pathway for UBE2C Gene
2 BioSystems pathways for UBE2C Gene
1 KEGG pathway for UBE2C Gene
1 R&D Systems pathway for UBE2C Gene
3 Qiagen pathways for UBE2C Gene
UniProtKB/Swiss-Prot O00762-UBE2C_HUMAN
- Pathway: Protein modification; protein ubiquitination.
Interacting Proteins for UBE2C Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0006511 | ubiquitin-dependent protein catabolic process | IDA | 9122200 |
GO:0007049 | cell cycle | IEA | -- |
GO:0010458 | exit from mitosis | IMP | 19822757 |
GO:0010994 | free ubiquitin chain polymerization | IDA | 19822757 |
GO:0016567 | protein ubiquitination | TAS | -- |
No data available for SIGNOR curated interactions for UBE2C Gene
Drugs & Compounds for UBE2C Gene
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
Phosphoric acid | Approved | Pharma | 0 | |||
Adenosine monophosphate | Approved, Investigational | Nutra | 0 | |||
ATP | Investigational | Nutra | Agonist | 0 | ||
NSC697923 | Pharma | Inhibitor of E2 complex Ubc13-Uev1A,cell permeable and selective, Selective UBE2N inhibitor | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
pyrophosphate |
|
14000-31-8 |
|
(1) ApexBio Compounds for UBE2C Gene
Compound | Action | Cas Number |
---|---|---|
NSC697923 | Inhibitor of E2 complex Ubc13-Uev1A,cell permeable and selective | 343351-67-7 |
Transcripts for UBE2C Gene
mRNA/cDNA for UBE2C Gene
- (8) REFSEQ mRNAs :
- (11) Additional mRNA sequences :
- (252) Selected AceView cDNA sequences:
- (8) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for UBE2C Gene
CRISPR Products
-
OriGene CRISPR knockouts for UBE2C
- genomics-online: gRNA clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
- Applied Biological Materials CRISPR for UBE2C
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for UBE2C
- GenScript: Design CRISPR guide RNA sequences for UBE2C
miRNA Products
- Search ViGene Biosciences for UBE2C
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for UBE2C
- Browse OriGene Inhibitory RNA Products For UBE2C
- genomics-online: shRNA clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for UBE2C gene
Clone Products
-
OriGene ORF clones in human for UBE2C
- RC208741
- RC208741L1
- RC208741L2
- RG219935
- RC219935L2
- RC219935L1
- RC219935
- RG200240
- RC200240L2
- RC200240L1
- RC200240
- RG212654
- RC212654L2
- RC212654L1
- RC212654
- RG222316
- RC222316L2
- RC222316L1
- RC222316
- RG208741
- RC235499
- RC235917
- RC219935L2V
- RC219935L1V
- RC200240L2V
- RC200240L1V
- RC212654L2V
- RC212654L1V
- RC222316L2V
- RC222316L1V
- RC208741L2V
- RC208741L1V
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for UBE2C
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for UBE2C
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for UBE2C
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for UBE2C
- Applied Biological Materials Clones for UBE2C
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1a | · | 1b | ^ | 2a | · | 2b | ^ | 3a | · | 3b | ^ | 4a | · | 4b | ^ | 5 | ^ | 6a | · | 6b |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | ||||||||||||||||||
SP2: | - | - | - | ||||||||||||||||||
SP3: | - | - | - | - | |||||||||||||||||
SP4: | - | - | - | - | |||||||||||||||||
SP5: | - | - | - | - | |||||||||||||||||
SP6: | - | ||||||||||||||||||||
SP7: | - | - | - | - | - | ||||||||||||||||
SP8: |
Expression for UBE2C Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Blood (Cardiovascular System)
-
Thymus (Hematopoietic System)
- Double Negative 2 Thymocytes Thymus
mRNA differential expression in normal tissues according to GTEx for UBE2C Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for UBE2C Gene
NURSA nuclear receptor signaling pathways regulating expression of UBE2C Gene:
UBE2CSOURCE GeneReport for Unigene cluster for UBE2C Gene:
Hs.93002Primer Products
-
OriGene qPCR primer pairs for UBE2C
-
OriGene qPCR primer pairs and template standards for UBE2C
- genomics-online: primer clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
No data available for mRNA Expression by UniProt/SwissProt , Evidence on tissue expression from TISSUES and Phenotype-based relationships between genes and organs from Gene ORGANizer for UBE2C Gene
Orthologs for UBE2C Gene
This gene was present in the common ancestor of eukaryotes.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | -- 34 |
|
OneToMany | |
-- 34 |
|
OneToMany | |||
UBE2C 33 |
|
||||
dog (Canis familiaris) |
Mammalia | UBE2C 33 34 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | UBE2C 34 |
|
OneToOne | |
cow (Bos Taurus) |
Mammalia | UBE2C 33 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | Ube2c 33 |
|
||
mouse (Mus musculus) |
Mammalia | Ube2c 33 16 34 |
|
||
platypus (Ornithorhynchus anatinus) |
Mammalia | UBE2C 34 |
|
OneToOne | |
chicken (Gallus gallus) |
Aves | UBE2C 33 34 |
|
||
tropical clawed frog (Silurana tropicalis) |
Amphibia | ube2c 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | ube2c 33 34 |
|
||
rainbow trout (Oncorhynchus mykiss) |
Actinopterygii | Omy.8806 33 |
|
||
fruit fly (Drosophila melanogaster) |
Insecta | vihar 35 |
|
|
|
vih 33 34 |
|
||||
African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP006238 33 |
|
||
baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | UBC11 33 34 36 |
|
||
thale cress (Arabidopsis thaliana) |
eudicotyledons | UBC19 33 |
|
||
Alicante grape (Vitis vinifera) |
eudicotyledons | Vvi.9379 33 |
|
||
rice (Oryza sativa) |
Liliopsida | Os01g0273100 33 |
|
||
Os.247 33 |
|
||||
barley (Hordeum vulgare) |
Liliopsida | Hv.2165 33 |
|
||
wheat (Triticum aestivum) |
Liliopsida | Ta.3436 33 |
|
||
sea squirt (Ciona savignyi) |
Ascidiacea | CSA.3903 34 |
|
OneToOne | |
fission yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | ubc11 33 |
|
||
sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.5287 33 |
|
- Species where no ortholog for UBE2C was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- lizard (Anolis carolinensis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- worm (Caenorhabditis elegans)
Paralogs for UBE2C Gene
(23) SIMAP similar genes for UBE2C Gene using alignment to 3 proteins:
Pseudogenes.org Pseudogenes for UBE2C Gene
Variants for UBE2C Gene
SNP ID | Clin | Chr 20 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1000133927 | -- | 45,813,221(+) | G/A | 5_prime_UTR_variant, intron_variant | |
rs1001117166 | -- | 45,811,909(+) | A/C | upstream_transcript_variant | |
rs1001280343 | -- | 45,810,823(+) | G/A/C | upstream_transcript_variant | |
rs1001371810 | -- | 45,812,501(+) | G/T | upstream_transcript_variant | |
rs1001764447 | -- | 45,816,344(+) | A/G | intron_variant |
Additional Variant Information for UBE2C Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- UBE2C
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for UBE2C Gene
Disorders for UBE2C Gene
Additional Disease Information for UBE2C
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No disorders were found for UBE2C Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for UBE2C Gene
Publications for UBE2C Gene
- Dominant-negative cyclin-selective ubiquitin carrier protein E2-C/UbcH10 blocks cells in metaphase. (PMID: 9122200) Townsley FM … Ruderman JV (Proceedings of the National Academy of Sciences of the United States of America 1997) 2 3 4 22 58
- Dual RING E3 Architectures Regulate Multiubiquitination and Ubiquitin Chain Elongation by APC/C. (PMID: 27259151) Brown NG … Schulman BA (Cell 2016) 3 4 58
- The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines. (PMID: 20061386) David Y … Navon A (The Journal of biological chemistry 2010) 3 4 58
- Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey SD … DREAM investigators (Diabetes care 2010) 3 44 58
- Overexpression of the E2 ubiquitin-conjugating enzyme UbcH10 causes chromosome missegregation and tumor formation. (PMID: 20065091) van Ree JH … van Deursen JM (The Journal of cell biology 2010) 3 22 58
Products for UBE2C Gene
- Browse R&D Systems for Antibodies
- R&D Systems Proteins and Enzymes for UBE2C (UbcH10/UBE2C)
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for UBE2C
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for UBE2C
- Origene Custom Protein Services for UBE2C
- Origene shrna, sirna, and RNAi products in human, mouse, rat for UBE2C
- Browse OriGene Inhibitory RNA Products For UBE2C
- OriGene qPCR primer pairs and template standards for UBE2C
- OriGene qPCR primer pairs for UBE2C
- OriGene CRISPR knockouts for UBE2C
- OriGene ORF clones in human for UBE2C
- RC208741L1V
- RC208741L2V
- RC222316L1V
- RC222316L2V
- RC212654L1V
- RC212654L2V
- RC200240L1V
- RC200240L2V
- RC219935L1V
- RC219935L2V
- RC235917
- RC235499
- RC208741
- RC208741L1
- RC208741L2
- RG208741
- RC222316
- RC222316L1
- RC222316L2
- RG222316
- RC212654
- RC212654L1
- RC212654L2
- RG212654
- RC200240
- RC200240L1
- RC200240L2
- RG200240
- RC219935
- RC219935L1
- RC219935L2
- RG219935
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For UBE2C
- GenScript: Next-day shipping of latest version cDNA ORF clones for UBE2C in any vector
- GenScript Purified and Recombinant Proteins for UBE2C
- GenScript Custom Purified and Recombinant Proteins Services for UBE2C
- GenScript Custom Assay Services for UBE2C
- GenScript Custom overexpressing Cell Line Services for UBE2C
- GenScript: Design CRISPR guide RNA sequences for UBE2C
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for UBE2C
- Cell Signaling Technology (CST) Antibodies for UBE2C (UBE2C)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for UBE2C
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Recombinant Proteins
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for UBE2C
- Novus Biologicals proteins and lysates for UBE2C
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for UBE2C
- Abcam proteins for UBE2C
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- ProSpec Recombinant Proteins for UBE2C
- Cloud-Clone Corp. Antibodies for UBE2C
- Cloud-Clone Corp. Proteins for UBE2C
- Cloud-Clone Corp. Assay Kits for UBE2C
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for UBE2C
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for UBE2C
- Cyagen custom Knockout/knockin (KOKI) mouse models for UBE2C
- VectorBuilder custom plasmid, inducible vectors for UBE2C
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for UBE2C
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Addgene plasmids for UBE2C
- antibodies-online: Search results for 142 available UBE2C Antibodies ranked by validation data
- Compare Top UBE2C Antibodies
- Quality Products:
- antibodies-online: Search results for 11 available UBE2C Elisa Kits ranked by validation data
- Compare Top UBE2C Elisa Kits
- Quality Products:
- antibodies-online: Search results for 27 available UBE2C Proteins ranked by validation data
- Compare Top UBE2C Proteins
- GeneTex UBE2C antibody for UBE2C
- Search GeneTex for Proteins for UBE2C
- ViGene Biosciences ready-to-package AAV shRNAs for UBE2C gene
- Search ViGene Biosciences for UBE2C
- Santa Cruz Biotechnology (SCBT) Antibodies for UBE2C
- Search Santa Cruz Biotechnology (SCBT) for UBE2C siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for UBE2C
- Search for UBE2C Antibodies at ProSci
- Custom Antibody Services
- ProSci Proteins for UBE2C
- Horizon Cell Lines for UBE2C
- genomics-online: cdna clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
- orf clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
- genomics-online: gRNA clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
- genomics-online: primer clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
- genomics-online: shRNA clones - Search results for 156 available UBE2C gene related products
- Overview of 156 available UBE2C gene related products
Sources for UBE2C Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew