Home
GeneCards Guide
Suite
- MalaCards
- GeneALaCart
- GeneAnalytics
- GeneLoc
- GenesLikeMe
- VarElect
- PathCards
Terms of Use
- Terms of Use
- 3rd Party Notice
About Us
- GeneCards Team
- Our Publications
- Citing GeneCards
- Licensing Agreement
- Weizmann Institute
- LifeMap Sciences Inc
User Feedback
GeneCards Plus
- Premium Tools
  
  Learn more

Set Analyses:

VarElect

Advanced Search

UBE2C Gene

protein-coding GIFtS: 69
GCID: GC20P044442

Ubiquitin-Conjugating Enzyme E2C

Try our

MalaCards

disease database

(According to ¹HGNC, ²Entrez Gene,
³UniProtKB/Swiss-Prot, ⁴UniProtKB/TrEMBL, ⁵OMIM, ⁶GeneLoc, ⁷Ensembl, ⁸DME, ⁹miRBase, ¹⁰fRNAdb, ¹²H-InvDB, ¹³NCBI, ¹⁴NONCODE, and/or ¹⁵RNAdb)
About This Section

TryGeneCards Plus

Aliases
Ubiquitin-Conjugating Enzyme E2C¹ ²		dJ447F3.2²
UBCH10² ³ ⁵		Mitotic-Specific Ubiquitin-Conjugating Enzyme²
Ubiquitin-Protein Ligase C² ³		Ubiquitin-Conjugating Enzyme E2 C²
EC 6.3.2.19³ ⁸		UbcH10³
Cyclin-Selective Ubiquitin Carrier Protein²		Ubiquitin Carrier Protein C³

External Ids:	HGNC: 15937¹	Entrez Gene: 11065²	Ensembl: ENSG00000175063⁷	OMIM: 605574⁵	UniProtKB: O00762³

Export aliases for UBE2C gene to outside databases

Previous GC identifers: GC20P044169 GC20P045079 GC20P045126 GC20P043874 GC20P041183

(According to Entrez Gene, GeneCards, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

TryGeneCards Plus

Entrez Gene summary for UBE2C Gene:

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or

short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes:

ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a

member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of

mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript

variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on

chromosomes 4, 14, 15, 18, and 19. (provided by RefSeq, Aug 2013)

GeneCards Summary for UBE2C Gene:

UBE2C (ubiquitin-conjugating enzyme E2C) is a protein-coding gene. GO annotations related to this gene include ubiquitin-protein ligase activity. An important paralog of this gene is ENSG00000258677.

UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762

Function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro

catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting

complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis.

Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C

substrates by the proteasome and promoting mitotic exit

Gene Wiki entry for UBE2C Gene

(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 75), Regulatory elements and Epigenetics data according to QIAGEN, and/or SwitchGear Genomics)
About This Section

TryGeneCards Plus

RefSeq DNA sequence at NCBI GenBank:

NC_000020.10 NC_018931.2 NT_011362.11

Regulatory elements:

Regulatory transcription factor binding sites in the UBE2C gene promoter:
c-Rel Pax-2 CP1A CP1C Pax-2a
Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): UBE2C promoter sequence

Search Chromatin IP Primers for UBE2C

Epigenetics:

DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat UBE2C

Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 20q13.12 Ensembl cytogenetic band: 20q13.12 HGNC cytogenetic band: 20q13.12

UBE2C Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
UBE2C gene location

GeneLoc information about chromosome 20 GeneLoc Exon Structure

GeneLoc location for GC20P044442: view genomic region (about GC identifiers)

Start:	44,441,215 bp from pter	End:	44,445,596 bp from pter
Size:	4,382 bases	Orientation:	plus strand

(According to ¹UniProtKB, HORDE, ²neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, Cloud-Clone Corp., eBioscience, and/or antibodies-online,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, Cloud-Clone Corp., eBioscience, and/or antibodies-online, Antibodies by EMD Millipore, R&D Systems, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, Cloud-Clone Corp, antibodies-online, and/or others.)
About This Section

TryGeneCards Plus

UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762 (See protein sequence)

Recommended Name: Ubiquitin-conjugating enzyme E2 C

Size: 179 amino acids; 19652 Da

Subunit: Component of the APC/C complex

1 PDB 3D structure from and Proteopedia for UBE2C:

1I7K (3D)

Secondary accessions: A6NP33 E1P5N7 G3XAB7

Alternative splicing: 4 isoforms: O00762-1 O00762-2 O00762-3 O00762-4 (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for UBE2C: NX_O00762

Explore proteomics data for UBE2C at MOPED

Post-translational modifications:

Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a

central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit

the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates

have been destroyed¹

Ubiquitination² at Lys80, Lys121

Modification sites at PhosphoSitePlus

4 DME Specific Peptides for UBE2C (O00762)

ICLDILK

QSLLGEPN

GTVYEDLRYKLSLEFPSGYPYNAPTVKF

VGKRLQQELMTLMMSGDKGISAFPESDNLFKW

See UBE2C Protein Expression from SPIRE MOPED, PaxDB, and MaxQB

REFSEQ proteins (6 alternative transcripts):

NP_001268670.1 NP_001268671.1 NP_008950.1 NP_861515.1 NP_861516.1 NP_861517.1

ENSEMBL proteins:

ENSP00000348838 ENSP00000335674 ENSP00000243893 ENSP00000333975 ENSP00000361649

ENSP00000385878

Reactome Protein details: O00762

UBE2C Human Recombinant Protein Products:

	EMD Millipore Purified and/or Recombinant UBE2C Protein
	R&D Systems Recombinant & Natural Proteins for UBE2C (UbcH10/UBE2C)
	Enzo Life Sciences proteins for UBE2C
	OriGene Purified Proteins for UBE2C OriGene Protein Over-expression Lysate for UBE2C OriGene MassSpec for UBE2C OriGene Custom Protein Services for UBE2C
	GenScript Purified and Recombinant Proteins for UBE2C
	Novus Biologicals UBE2C Proteins Novus Biologicals UBE2C Lysates
	Browse Sino Biological Recombinant Proteins Browse Sino Biological Cell Lysates
	ProSpec Recombinant Protein for UBE2C
	Cloud-Clone Corp. Proteins for UBE2C
	Search eBioscience for Proteins for UBE2C
	antibodies-online proteins for UBE2C (32 products)
	antibodies-online peptides for UBE2C

UBE2C Antibody Products:

	EMD Millipore Mono- and Polyclonal Antibodies for the study of UBE2C
	R&D Systems Antibodies for UBE2C (UbcH10/UBE2C)
	OriGene Antibodies for UBE2C OriGene Custom Antibody Services for UBE2C
	Novus Biologicals UBE2C Antibodies
	Abcam antibodies for UBE2C
	Cloud-Clone Corp. Antibodies for UBE2C
	ThermoFisher Antibodies for UBE2C
	antibodies-online antibodies for UBE2C (59 products)

UBE2C Assay Products:

	Browse Kits and Assays available from EMD Millipore
	OriGene Custom Assay Services for UBE2C
	Browse R&D Systems for biochemical assays
	GenScript Custom Assay Services for UBE2C
	Browse Enzo Life Sciences for kits & assays
	Cloud-Clone Corp. ELISAs for UBE2C Cloud-Clone Corp. CLIAs for UBE2C
	Search eBioscience for ELISAs for UBE2C
	antibodies-online kits for UBE2C (13 products)

(According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
About This Section

TryGeneCards Plus

HGNC Gene Families:

UBE2: Ubiquitin-conjugating enzymes E2

3 InterPro protein domains:

IPR023313 UBQ-conjugating_AS

IPR000608 UBQ-conjugat_E2

IPR016135 UBQ-conjugating_enzyme/RWD

Graphical View of Domain Structure for InterPro Entry O00762

ProtoNet protein and cluster: O00762

1 Blocks protein domain: IPB000608 Ubiquitin-conjugating enzymes

UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762

Similarity: Belongs to the ubiquitin-conjugating enzyme family

Find genes that share domains with UBE2C About GenesLikeMe

(According to ¹UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or ²DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, genOway,
transcription factor targeting from QIAGEN and/or HOMER, miRNA Gene Targets from miRTarBase, shRNA from OriGene, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, SwitchGear Genomics, Gene Editing from DNA2.0, Clones from OriGene, GenScript, Sino Biological, DNA2.0, Vector BioLabs and/or Addgene, Cell Lines from GenScript, ESI BIO, In Situ Hybridization Assays from Advanced Cell Diagnostics, Flow cytometry from eBioscience, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
About This Section

TryGeneCards Plus

Molecular Function:

UniProtKB/Swiss-Prot Summary: UBE2C_HUMAN, O00762

Function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro

catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting

complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis.

Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C

substrates by the proteasome and promoting mitotic exit

Catalytic activity: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine

Enzyme Number (IUBMB): EC 6.3.2.19¹ ²

Gene Ontology (GO): 4 molecular function terms: About this table

GO ID	Qualified GO term	Evidence	PubMed IDs
GO:0004842	contributes to ubiquitin-protein ligase activity	IDA	18485873
GO:0005515	protein binding	IPI	19822757
GO:0005524	ATP binding	IEA	--
GO:0016881	acid-amino acid ligase activity	--	--

Find genes that share ontologies with UBE2C About GenesLikeMe

Phenotypes:
3 GenomeRNAi human phenotypes for UBE2C:

Decreased cilium length after

Decreased viability

Upregulation of Wnt/beta-caten

1 MGI phenotypic allele

for Ube2c (no phenotypes)

Find genes that share phenotypes with UBE2C About GenesLikeMe

Animal Models:
MGI mouse knock-out Ube2c^{tm1(KOMP)Wtsi} for UBE2C

genOway: Develop your customized and physiologically relevant rodent model for UBE2C

miRNA Products:		miRTarBase miRNAs that target UBE2C: hsa-mir-671-5p (MIRT039262), hsa-mir-16-5p (MIRT031394), hsa-mir-140-3p (MIRT021680), hsa-mir-196a-5p (MIRT048197), hsa-mir-615-3p (MIRT040327), hsa-mir-193b-3p (MIRT016310), hsa-mir-20a-5p (MIRT050549), hsa-mir-17-5p (MIRT050874), hsa-mir-24-3p (MIRT030369)

		Block miRNA regulation of human, mouse, rat UBE2C using miScript Target Protectors
		Search for qRT-PCR Assays for microRNAs that regulate UBE2C
		SwitchGear 3'UTR luciferase reporter plasmid: UBE2C 3' UTR sequence

Inhib. RNA Products:		OriGene RNAi products in human, mouse, rat for UBE2C
		Predesigned siRNA for gene silencing in human, mouse, rat UBE2C

Gene Editing
Products:

DNA2.0 Custom Protein Engineering Service for UBE2C

Clone Products:		OriGene clones in human, mouse for UBE2C (see all 34) OriGene ORF clones in mouse, rat for UBE2C OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
		GenScript: all cDNA clones in your preferred vector (see all 6): UBE2C (NM_007019)
		Sino Biological Human cDNA Clone for UBE2C
		DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2C
		Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2C
		Addgene plasmids for UBE2C

Cell Line Products:		GenScript Custom overexpressing Cell Line Services for UBE2C
		Browse ESI BIO Cell Lines and PureStem Progenitors for UBE2C

In Situ Assay
Products:

Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2C

Flow Cytometry
Products:

eBioscience FlowRNA Probe Sets ( VA1-10346) for UBE2C

(According to UniProtKB, COMPARTMENTS Subcellular localization database, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
About This Section

TryGeneCards Plus

Subcellular locations from COMPARTMENTS:

Compartment	Confidence
nucleus	5
cytosol	4
cytoskeleton	1
endoplasmic reticulum	1
mitochondrion	1
peroxisome	1
plasma membrane	1

About this image

Gene Ontology (GO): 3 cellular component terms: About this table

GO ID	Qualified GO term	Evidence	PubMed IDs
GO:0005654	nucleoplasm	TAS	--
GO:0005680	anaphase-promoting complex	IDA	18485873
GO:0005829	cytosol	TAS	--

Find genes that share ontologies with UBE2C About GenesLikeMe

(SuperPaths according to PathCards, Pathways according to R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to QIAGEN, and/or STRING, Interactions according to ¹UniProtKB, ²MINT, ³I2D, and/or ⁴STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene).
About This Section

TryGeneCards Plus

SuperPaths for UBE2C About (see all 11)

See pathways by source

Powered
by

SuperPath

Selected contained pathways About (see all per SuperPath)

Class I MHC mediated antigen processing and presentation

	Class I MHC mediated antigen processing and presentation	0.84			Adaptive Immune System	0.41
	Antigen processing- Ubiquitination and Proteasome degradation	0.84			Ubiquitin mediated proteolysis	0.35

CDK-mediated phosphorylation and removal of Cdc6

APC/C-mediated degradation of cell cycle proteins	0.94	Activation of APC/C and APC/C-Cdc20 mediated degradation of mitotic proteins	0.92
Regulation of mitotic cell cycle	0.94	Autodegradation of Cdh1 by Cdh1-APC/C	0.91
Regulation of APC/C activators between G1/S and early anaphase	0.94	Cell Cycle Checkpoints	0.58
APC/C-Cdc20 mediated degradation of Securin	0.93	Phosphorylation of the APC/C	0.00

Inactivation of APC/C via direct inhibition of the APC/C complex

	Inactivation of APC/C via direct inhibition of the APC/C complex	0.64			APC/C-Cdc20 mediated degradation of Cyclin B	0.64
	Inhibition of the proteolytic activity of APC/C required for the onset of anaphase by mitotic spindle checkpoint components	0.64			Mitotic Spindle Checkpoint	0.62

Mitotic Metaphase and Anaphase

	Separation of Sister Chromatids	0.94			Mitotic Metaphase and Anaphase	0.93
	Mitotic Anaphase	0.94

Cell Cycle, Mitotic

	Cell Cycle, Mitotic	0.90			M Phase	0.62
	Cell Cycle	0.90

Find genes that share SuperPaths with UBE2C About GenesLikeMe

Pathways by source See SuperPaths
Show all pathways

3 Downloadable PowerPoint Slides of GeneGlobe Pathway Central Maps for UBE2C

	Ubiquitin-Proteasome Dependent Proteolysis
	Remodeling of Adherens Junctions
	SOCS Pathway

2 BioSystems Pathways for UBE2C

	Gastric cancer network 1
	Gastric cancer network 2

Selected Reactome Pathways for UBE2C (see all 12)

	APC/C:Cdc20 mediated degradation of mitotic proteins
	Autodegradation of Cdh1 by Cdh1:APC/C
	Phosphorylation of the APC/C
	Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
	APC/C:Cdc20 mediated degradation of Securin

1 Kegg Pathway (Kegg details for UBE2C):

Ubiquitin mediated proteolysis

UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762

Pathway: Protein modification; protein ubiquitination

Pathway & Disease-focused RT² Profiler PCR Array including UBE2C:

Ubiquitination (Ubiquitylation) Pathway in human mouse rat

Interactions:

GeneGlobe Interaction Network for UBE2C

STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

Selected Interacting proteins for UBE2C (O00762³ ENSP00000348838⁴) via UniProtKB, MINT, STRING, and/or I2D (see all 118)

Interactant		Interaction Details
GeneCard	External ID(s)	Interaction Details
ANAPC11	Q9NYG5³, ENSP00000349957⁴	I2D: score=1 STRING: ENSP00000349957
PCGF3	Q3KNV8³, ENSP00000354724⁴	I2D: score=1 STRING: ENSP00000354724
POLM	Q9NP87³, ENSP00000242248⁴	I2D: score=1 STRING: ENSP00000242248
RANBP9	Q96S59³, ENSP00000011619⁴	I2D: score=1 STRING: ENSP00000011619
UBASH3B	Q8TF42³, ENSP00000284273⁴	I2D: score=1 STRING: ENSP00000284273

About this table

Gene Ontology (GO): Selected biological process terms (see all 18): About this table

GO ID	Qualified GO term	Evidence	PubMed IDs
GO:0000278	mitotic cell cycle	TAS	--
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	18485873
GO:0007049	cell cycle	NAS	15504738
GO:0007051	spindle organization	NAS	15504738
GO:0007094	mitotic spindle assembly checkpoint	TAS	--

Find genes that share ontologies with UBE2C About GenesLikeMe

(Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience, ApexBio, HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB)
About This Section

TryGeneCards Plus

Browse Small Molecules at EMD Millipore

Browse drugs & compounds from Enzo Life Sciences

Browse compounds at ApexBio

Browse Tocris compounds for UBE2C

4 HMDB Compounds for UBE2C About this table

Compound	Synonyms	CAS #	PubMed Ids
Adenosine monophosphate	5'-AMP (see all 28)	61-19-8	--
Adenosine triphosphate	5'-(tetrahydrogen triphosphate) Adenosine (see all 24)	56-65-5	--
Phosphoric acid	acide phosphorique (FRENCH) (see all 20)	7664-38-2	--
Pyrophosphate	(4-)Diphosphoric acid ion (see all 10)	14000-31-8	--

2 Novoseek inferred chemical compound relationships for UBE2C gene About this table

Compound	-log (P-Val)	Hits	PubMed IDs for Articles with Shared Sentences (# sentences)
lysine	19.1	1	14732013 (1)
oligonucleotide	11.8	1	17217624 (1)

Find genes that share compounds with UBE2C About GenesLikeMe

(Secondary structures according to fRNAdb,
GenBank/EMBL/DDBJ Accessions according to
Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
RefSeq according to Entrez Gene,
DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN, SwitchGear Genomics,
Tagged/untagged cDNA clones from OriGene, GenScript, DNA2.0, Vector BioLabs, and/or Addgene, Primers from OriGene, and/or QIAGEN, Flow cytometry from eBioscience )
About This Section

TryGeneCards Plus

REFSEQ mRNAs for UBE2C gene (8 alternative transcripts):

NM_001281741.1 NM_001281742.1 NM_007019.3 NM_181799.2 NM_181800.2 NM_181801.3 NM_181802.1 NM_181803.1

Unigene Cluster for UBE2C:

Ubiquitin-conjugating enzyme E2C

Hs.93002 [show with all ESTs]

Unigene Representative Sequence: BC032677

7 Ensembl transcripts including schematic representations, and UCSC links where relevant:

ENST00000356455(uc002xpm.3 uc002xpo.3 uc002xpp.3) ENST00000335046(uc002xpl.3)

ENST00000243893 ENST00000352551 ENST00000372568(uc002xpq.3) ENST00000496085

ENST00000405520(uc002xpn.3)

miRNA Products:		Block miRNA regulation of human, mouse, rat UBE2C using miScript Target Protectors
		Search for qRT-PCR Assays for microRNAs that regulate UBE2C
		SwitchGear 3'UTR luciferase reporter plasmid: UBE2C 3' UTR sequence

Inhib. RNA Products:		OriGene RNAi products in human, mouse, rat for UBE2C
		Predesigned siRNA for gene silencing in human, mouse, rat UBE2C

Clone Products:		OriGene clones in human, mouse for UBE2C (see all 34) OriGene ORF clones in mouse, rat for UBE2C OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
		GenScript: all cDNA clones in your preferred vector (see all 6): UBE2C (NM_007019)
		DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2C
		Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2C
		Addgene plasmids for UBE2C

Primer Products:		OriGene qPCR primer pairs and template standards for UBE2C OriGene qSTAR qPCR primer pairs in human, mouse for UBE2C
		Pre-validated RT² qPCR Primer Assay in human, mouse, rat UBE2C
		QuantiTect SYBR Green Assays in human, mouse, rat UBE2C
		QuantiFast Probe-based Assays in human, mouse, rat UBE2C

Flow Cytometry
Products:

eBioscience FlowRNA Probe Sets ( VA1-10346) for UBE2C

Additional mRNA sequence:

AK311949.1 BC007656.2 BC016292.1 BC028161.1 BC032677.2 BC050736.1 BT007300.1 BT020165.1

BT020166.1 CR456988.1 U73379.1

17 DOTS entries:

DT.455083 DT.446076 DT.101984847 DT.91766689 DT.95092516 DT.101984846 DT.100822418 DT.120817240

DT.120817711 DT.102842123 DT.102842126 DT.120817606 DT.102842114 DT.120817859 DT.95189185 DT.95245584

DT.100038110

Selected AceView cDNA sequences (see all 252):

BM556795 BM467729 CA429608 BM423477 BI870709 BE268039 BC007656 BC028161

BM557700 BE797203 BC050736 BX344527 BQ218554 BQ676468 BU509336 CR610834

BM755952 BM845270 AI264541 BU625723 BM781915 BC016292 BM698699 BU844974

GeneLoc Exon Structure

Selected Alternative Splicing Database (ASD) splice patterns (SP) for UBE2C (see all 8) About this scheme

ExUns:	1a	·	1b	^	2a	·	2b	^	3a	·	3b	^	4a	·	4b	^	5	^	6a	·	6b
SP1:							-		-				-
SP2:							-		-						-
SP3:							-		-				-		-
SP4:							-		-		-				-
SP5:							-		-		-		-

ECgene alternative splicing isoforms for UBE2C

(RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, Protein expression images according to data from SPIRE ¹MOPED, ²PaxDb, and ³MaxQB, plus additional links to SOURCE, and/or BioGPS, and/or UniProtKB,
PCR Arrays from QIAGEN, Primers from OriGene, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
About This Section

TryGeneCards Plus

UBE2C expression in normal human tissues (normalized intensities)
See probesets specificity/sensitivity at GeneAnnot
About this imageBioGPS <intensity>^2/3
CGAP TAG: CTGCCGAGCT

About this image

UBE2C expression in embryonic tissues and stem cells About this table

Data from LifeMap, the Embryonic Development and Stem Cells Database
selected tissues (see all 2) fully expand


Blood (Cardiovascular System) fully expand to see all 3 entries
Double Negative 2 Thymocytes Thymus
Bone marrow-derived hematopoietic stem cells (family)

Thymus (Hematopoietic System)
Double Negative 2 Thymocytes Thymus

UBE2C Protein expression data from MOPED¹, PaxDb² and MaxQB³:

About this image

UBE2C Protein Expression

SOURCE GeneReport for Unigene cluster: Hs.93002

Pathway & Disease-focused RT² Profiler PCR Array including UBE2C:

Ubiquitination (Ubiquitylation) Pathway in human mouse rat

Primer Products:		OriGene qPCR primer pairs and template standards for UBE2C OriGene qSTAR qPCR primer pairs in human, mouse for UBE2C
		Pre-validated RT² qPCR Primer Assay in human, mouse, rat UBE2C
		QuantiTect SYBR Green Assays in human, mouse, rat UBE2C
		QuantiFast Probe-based Assays in human, mouse, rat UBE2C

In Situ
Assay Products:

Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2C

(Orthologs according to ^1,2HomoloGene (²older version, for species not in ¹newer version), ³euGenes, ⁴SGD , ⁵MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or ⁶Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
About This Section

TryGeneCards Plus

This gene was present in the common ancestor of eukaryotes.

Orthologs for UBE2C gene from Selected species (see all 24) About this table

Organism	Taxonomic classification	Gene	Description	Human Similarity	Details
mouse (Mus musculus)	Mammalia	Ube2c^{1 , 5}	ubiquitin-conjugating enzyme E2C^{1, 5}	87.52(n)¹ 95.53(a)¹	2 (85.27 cM)⁵ 68612¹ NM_026785.2¹ NP_081061.1¹ 164769898⁵
chicken (Gallus gallus)	Aves	UBE2C¹	ubiquitin-conjugating enzyme E2C	78.41(n) 88.57(a)	100859413 XM_003642470.2 XP_003642518.2
African clawed frog (Xenopus laevis)	Amphibia	48017932²	--	77.83(n)	48017932
zebrafish (Danio rerio)	Actinopterygii	ube2c¹	ubiquitin-conjugating enzyme E2C	68.44(n) 76.92(a)	566441 NM_001037691.2 NP_001032780.1
fruit fly (Drosophila melanogaster)	Insecta	vihar³ vih¹	ubiquitin conjugating enzyme³ vihar¹	66(a)³ 65.5(n)¹ 66.43(a)¹	69C4³ 44118¹ NM_140325.3¹ NP_648582.1¹
baker's yeast (Saccharomyces cerevisiae)	Saccharomycetes	UBC11(YOR339C)⁴ UBC11¹	Ubiquitin-conjugating enzyme most similar in sequence more⁴ UBC11¹	56.25(n)¹ 63.28(a)¹	15(958832-958362)⁴ 854517^{1, 4} NP_014984.3¹ NP_014984.1⁴
thale cress (Arabidopsis thaliana)	eudicotyledons	UBC19¹	UBC19	58.9(n) 59.51(a)	821545 NM_112897.3 NP_566653.1
rice (Oryza sativa)	Liliopsida	Os.247²	Oryza sativa (japonica cultivar-group) cDNA clone0 more	75.21(n)	AK105320.1

ENSEMBL Gene Tree for UBE2C (if available)
TreeFam Gene Tree for UBE2C (if available)

(Paralogs according to ¹HomoloGene,
²Ensembl, and ³SIMAP, Pseudogenes according to ⁴Pseudogene.org Build 68)
About This Section

TryGeneCards Plus

Paralogs for UBE2C gene

ENSG00000258677² UBE2W²

Selected SIMAP similar genes for UBE2C using alignment to 3 protein entries: UBE2C_HUMAN (see all proteins) (see all similar genes):

HR6A UBE2A UBE2U UBE2B UBE2H UBE2D4

UBE2K UBE2N UBE2D3 UBE2D2 UBE2D1 UBE2S

UBE2M UBE2NL UBE2E1 UBE2W UBE2E3 CDC34

Find genes that share paralogs with UBE2C About GenesLikeMe

5 Pseudogenes.org Pseudogenes for UBE2C
PGOHUM00000247755 PGOHUM00000247067 PGOHUM00000234895 PGOHUM00000250630 PGOHUM00000245919

(SNPs/Variants according to the ¹NCBI SNP Database, ²Ensembl, ³PupaSUITE, ⁴UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD), the Human Cytochrome P450 Allele Nomenclature Database, and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers, Cancer Mutation PCR Arrays and Assays, and Copy Number PCR Arrays from QIAGEN)
About This Section

TryGeneCards Plus

SNP ID	Valid	Clinical significance	Chr 20 pos	Sequence	#	AA Chg	Type	More	#	Allele freq	Pop	Total sample	More
Genomic Data					Transcription Related Data				Allele Frequencies
				--	--	--		--	--
rs189415161^1,2		--	44440630(+)	`CTGGTA/CTCGAA`	6	--	us2k¹		0	--	--	--	--
rs8122973^1,2	C,F	--	44440635(+)	`ctcgaT/Actcct`	6	--	us2k¹		2		WA CSA	3
rs368622^1,2	C,F,A,H	--	44440690(-)	`ACGTCT/CGTAAT`	6	--	us2k¹		15		NS EA WA NA CSA	791
rs6094213^1,2	H	--	44440726(+)	`ATGTTG/TCCTTT`	6	--	us2k¹		4		NS EA	394
rs73124741^1,2	C,F	--	44440737(+)	`TTTTAT/CTTCTG`	6	--	us2k¹		3		NA WA	240
rs73911113^1,2	C,F	--	44440990(+)	`AGAAGG/AAGGGG`	6	--	us2k¹		2		WA	120
rs181303907^1,2		--	44441088(+)	`CAGCAG/TCATCT`	6	--	us2k¹		0	--	--	--	--
rs73124742^1,2	C,F	--	44441090(+)	`GCATCA/GTCTAC`	6	--	us2k¹		3		NA WA	240
rs183815993^1,2		--	44441175(+)	`AATAGA/GGCGCT`	6	--	us2k¹		0	--	--	--	--
rs75169454^1,2	C	--	44441237(+)	`ACGCCC/TCCAGA`	6	--	us2k¹		0	--	--	--	--

HapMap Linkage Disequilibrium report for UBE2C (44441215 - 44445596 bp)

Structural Variations
Database of Genomic Variants (DGV) 1 variation for UBE2C: About this table

Variant ID	Type	Subtype	PubMed ID
nsv833990	CNV	Loss	17160897

Site Specific Mutation Identification with PCR Assays

1 Copy Number PCR Panel containing UBE2C:

Ovarian Cancer

SeqTarget long-range PCR primers for resequencing UBE2C

DNA2.0 Custom Variant and Variant Library Synthesis for UBE2C

(in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
About This Section

TryGeneCards Plus

OMIM gene information: 605574 OMIM disorders: --

Find genes that share disorders with UBE2C About GenesLikeMe

3 Novoseek inferred disease relationships for UBE2C gene About this table

Disease	-log (P-Val)	Hits	PubMed IDs for Articles with Shared Sentences (# sentences)
primary tumor	15.8	2	16772118 (1)
tumors	6.27	15	20065091 (4), 20099376 (4), 18331723 (1), 17217624 (1) (see all 6)
metastasis	0	1	16772118 (1)

Genetic Association Database (GAD): UBE2C
Human Genome Epidemiology (HuGE) Navigator: UBE2C (3 documents)

Export disorders for UBE2C gene to outside databases

(in PubMed. Associations of this gene to articles via ¹Entrez Gene, ²UniProtKB/Swiss-Prot, ³HGNC, ⁴GAD, ⁵PharmGKB, ⁶HMDB, ⁷DrugBank, ⁸UniProtKB/TrEMBL, ⁹ Novoseek, and/or ¹⁰fRNAdb)
About This Section

TryGeneCards Plus

PubMed articles for UBE2C gene, integrated from 10 sources (see all 130):
(articles sorted by number of sources associating them with UBE2C)

Utopia: connect your pdf to the dynamic
world of online information

Dominant-negative cyclin-selective ubiquitin carrier protein E2- C/UbcH10 blocks cells in metaphase. (PubMed id 9122200)^{1, 2, 3, 9} Townsley F.M.... Ruderman J.V. (Proc. Natl. Acad. Sci. U.S.A. 1997)
Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PubMed id 20628086)^{1, 4} Bailey S.D....Anand S. (Diabetes Care 2010)
Identification of a physiological E2 module for the human anaphase- promoting complex. (PubMed id 19822757)^{1, 2} Williamson A....Rape M. (Proc. Natl. Acad. Sci. U.S.A. 2009)
UBE2S elongates ubiquitin chains on APC/C substrates to promote mitotic exit. (PubMed id 19820702)^{1, 2} Garnett M.J.... Venkitaraman A.R. (Nat. Cell Biol. 2009)
Mechanism of ubiquitin-chain formation by the human anaphase- promoting complex. (PubMed id 18485873)^{1, 2} Jin L.... Rape M. (Cell 2008)
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)^{1, 2} Gerhard D.S.... Malek J. (Genome Res. 2004)
Structural and functional analysis of the human mitotic-specific ubiquitin-conjugating enzyme, UbcH10. (PubMed id 11927573)^{1, 2} Lin Y.... Basavappa R. (J. Biol. Chem. 2002)
The DNA sequence and comparative analysis of human chromosome 20. (PubMed id 11780052)^{1, 2} Deloukas P....Rogers J. (Nature 2001)
Identification of overexpressed genes in hepatocellular carcinoma, with special reference to ubiquitin-conjugating enzyme E2C gene expression. (PubMed id 17354233)^{1, 9} Ieta K....Mori M. (Int. J. Cancer 2007)
Expression and effect of inhibition of the ubiquitin-conjugating enzyme E2C on esophageal adenocarcinoma. (PubMed id 17217624)^{1, 9} Lin J....Lin L. (Neoplasia 2006)

(in PubMed, OMIM, and NCBI Bookshelf)
About This Section

TryGeneCards Plus

		AND	OR
Aliases
Disorders
Free Text

Query String		PubMed OMIM NCBI Bookshelf
	(Note: In FireFox, select the above section and copy using Ctrl-C)

(According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
About This Section

TryGeneCards Plus

Entrez Gene: 11065	HGNC: 15937	AceView: UBE2C	Ensembl:ENSG00000175063	euGenes: HUgn11065
ECgene: UBE2C	Kegg: 11065	H-InvDB: UBE2C

(According to HUGE)
About This Section

TryGeneCards Plus

(According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL, and/or others, e.g. Wikipedia and GeneReviews, via UniProtKB/Swiss-Prot)
About This Section

TryGeneCards Plus

Name	Description
PharmGKB entry for UBE2C	Pharmacogenomics, SNPs, Pathways
ATLAS Chromosomes in Cancer entry for UBE2C	Genetics and Cytogenetics in Oncology and Haematology

Intellectual Property for UBE2C gene
(Patent information from GeneIP, Licensable technologies from WIS Yeda, Salk, Tufts, IP news from LifeMap Sciences, Inc.)

About This Section

TryGeneCards Plus

Patent Information for UBE2C gene:
Search GeneIP for patents involving UBE2C

GeneCards and IP:
Japan Patent Office Licenses GeneCards European Patent Office Licenses GeneCards Improving the IP Search

(Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, eBioscience, antibodies-online, and/or others, Gene Editing from DNA2.0. Clones from OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Addgene, Cell lines from GenScript, and ESI BIO, Flow cytometery from eBioscience, PCR Arrays from QIAGEN, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, Enzo Life Sciences, and/or ApexBio, In Situ Hybridization Assays from
Advanced Cell Diagnostics, Animal models from genOway)
About This Section

TryGeneCards Plus

	Browse Kits and Assays available from EMD Millipore
	Browse Small Molecules at EMD Millipore
	EMD Millipore Mono- and Polyclonal Antibodies for the study of UBE2C
	EMD Millipore Purified and/or Recombinant UBE2C Protein

	EMD Millipore genomic analysis products

	Antibodies for UBE2C (UbcH10/UBE2C)		Browse Cell Culture Products
	Browse ELISAs		Browse Flow Cytometry Kits
	Browse Primer Pairs		Browse Enzyme Activity Assays/Reagents
	Browse ELISpot/FluoroSpot Kits/Development Modules		Browse TFB/Immunoprecipitation Assays
	Browse Apoptosis Detection Kits/Reagents		Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents
	Browse DNA Damage/Repair Kits/Reagents		Browse Luminex Assays
	Browse Cell Selection/Detection Kits/Reagents		Browse Secondary Antibodies/Controls/Staining Reagents
	Recombinant/Natural Proteins for UBE2C (UbcH10/UBE2C)		Browse Stem Cell Products
	Browse cDNA Clones		Browse Proteome Profiler Antibody Arrays

	OriGene Antibodies for UBE2C		OriGene RNAi products in human, mouse, rat for UBE2C
	OriGene qPCR primer pairs and template standards for UBE2C		OriGene Protein Over-expression Lysate for UBE2C
	OriGene MassSpec for UBE2C		OriGene clones in human, mouse for UBE2C
	OriGene qSTAR qPCR primer pairs in human, mouse for UBE2C		OriGene Purified Protein for UBE2C
	OriGene ORF clones in mouse, rat for UBE2C		OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
	OriGene Custom Antibody Services for UBE2C		OriGene Custom Protein Services for UBE2C

	Block miRNA regulation of human, mouse, rat UBE2C using miScript Target Protectors		SeqTarget long-range PCR primers for resequencing UBE2C
	DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat UBE2C		Predesigned siRNA for gene silencing in human, mouse, rat UBE2C
	QuantiFast Probe-based Assays in human, mouse, rat UBE2C		QuantiTect SYBR Green Assays in human, mouse, rat UBE2C
	PCR Arrays including human, mouse, rat UBE2C		Search Chromatin IP Primers for UBE2C
	Pre-validated RT² qPCR Primer Assay in human, mouse, rat UBE2C		GeneGlobe Interaction Network for UBE2C
	Regulatory tfbs in UBE2C promoter

	GenScript Purified and Recombinant Proteins for UBE2C		GenScript cDNA clones with any tag delivered in your preferred vector for UBE2C
	GenScript Custom Assay Services for UBE2C		GenScript Custom overexpressing Cell Line Services for UBE2C
	CloneReady with Over 120,000 Genes		Gene Synthesis: Any Gene in Any Vector
	Vector-based siRNA and miRNA, Ready for Transfection		Gene Mutant Library, Variants up to 10^11
	Plasmid Preparation		Custom Peptide Services

Search for Antibodies & Assays

Search Tocris compounds for UBE2C

	Browse Sino Biological Proteins
	Browse Sino Biological Cell Lysates
	cDNA Clones for UBE2C
	4000+ Proteins
	Search Sino Biological for antibodies, proteins & pathways
	Protein Production Services
	Transfection Reagents
	Protein A/G/L resins
	Isotyping reagents

	Proteins for UBE2C
	Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies

	Novus Tissue Slides
	UBE2C antibodies
	UBE2C proteins
	UBE2C lysates

	Antibodies for UBE2C
	See all of Abcam's Antibodies, Kits and Proteins for UBE2C
	Custom Antibody / Protein Production Service
	Bulk Purchasing
	Advantages of Rabbit Monoclonal antibodies
	Abcam protocols and scientific support

Recombinant Protein for UBE2C

	Proteins for UBE2C
	Antibodies for UBE2C
	ELISAs for UBE2C
	CLIAs for UBE2C

Browse ESI BIO Cell Lines and PureStem Progenitors for UBE2C

	Gene Synthesis
	Protein Engineering
	Variant Library Synthesis
	Codon Optimization
	Protein Production and Purification

Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2C

	SwitchGear 3'UTR luciferase reporter plasmids for UBE2C
	SwitchGear Promoter luciferase reporter plasmids for UBE2C

ThermoFisher Antibodies for UBE2C

Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2C

Browse compounds at ApexBio

Addgene plasmids for UBE2C

	Search eBioscience for proteins for UBE2C
	Search eBioscience for elisas for UBE2C
	eBioscience FlowRNA Probe Sets

genOway: Develop your customized and physiologically relevant rodent model for UBE2C

	antibodies-online antibodies for UBE2C (59 products)
	antibodies-online kits for UBE2C (13 products)
	antibodies-online peptides for UBE2C
	antibodies-online proteins for UBE2C (32 products)

GeneCards Homepage - Last full update: 7 May 2014 - Incrementals: 9 May 2014 , 2 Jun 2014 , 26 Jun 2014 , 30 Jun 2014 , 21 Aug 2014 , 8 Sep 2014 , 2 Nov 2014 , 8 Jan 2015

View Random Gene

Category			(GIFtS: )
GIFtS Group

The GeneCards human gene database gene index: 1 3 5 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

The GeneCards Human Gene Database

Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

Hot genes Disease genes UBE2C gene at Home site.

Version: 3.12.300 21 Jan 2015
hostname: 356980-web2.xennexinc.com index build: 128 solr: 1.4

GeneCards Plus

Advanced Search

Export list of displayed genes

UBE2C Gene

Ubiquitin-Conjugating Enzyme E2C

Aliases
for UBE2C gene

Summaries
for UBE2C gene

Genomic Views
for UBE2C gene

Proteins
for UBE2C gene

UBE2C Human Recombinant Protein Products:

UBE2C Antibody Products:

UBE2C Assay Products:

Domains /
Families
for UBE2C gene

Function
for UBE2C gene

Localization
for UBE2C gene

Pathways & Interactions
for UBE2C gene

Drugs & Compounds
for UBE2C gene

Transcripts
for UBE2C gene

Expression
for UBE2C gene

Orthologs
for UBE2C gene

Paralogs
for UBE2C gene

Genomic Variants
for UBE2C gene

Disorders / Diseases
for UBE2C gene

Publications
for UBE2C gene

External Searches for UBE2C gene

Genome Databases showing UBE2C gene

Other Databases showing UBE2C gene

Specialized Databases showing UBE2C gene

Intellectual Property
for UBE2C gene

Products
for UBE2C gene

View Random Gene

GeneCards Plus

Advanced Search

Export list of displayed genes

UBE2C Gene

Ubiquitin-Conjugating Enzyme E2C

Aliasesfor UBE2C gene

Summariesfor UBE2C gene

Genomic Viewsfor UBE2C gene

Proteinsfor UBE2C gene

UBE2C Human Recombinant Protein Products:

UBE2C Antibody Products:

UBE2C Assay Products:

Domains /Familiesfor UBE2C gene

Functionfor UBE2C gene

Localizationfor UBE2C gene

Pathways & Interactionsfor UBE2C gene

Drugs & Compoundsfor UBE2C gene

Transcriptsfor UBE2C gene

Expression for UBE2C gene

Orthologsfor UBE2C gene

Paralogsfor UBE2C gene

Genomic Variantsfor UBE2C gene

Disorders / Diseasesfor UBE2C gene

Publicationsfor UBE2C gene

External Searches for UBE2C gene

Genome Databases showing UBE2C gene

Other Databases showing UBE2C gene

Specialized Databases showing UBE2C gene

Intellectual Propertyfor UBE2C gene

Productsfor UBE2C gene

View Random Gene

Aliases
for UBE2C gene

Summaries
for UBE2C gene

Genomic Views
for UBE2C gene

Proteins
for UBE2C gene

Domains /
Families
for UBE2C gene

Function
for UBE2C gene

Localization
for UBE2C gene

Pathways & Interactions
for UBE2C gene

Drugs & Compounds
for UBE2C gene

Transcripts
for UBE2C gene

Expression
for UBE2C gene

Orthologs
for UBE2C gene

Paralogs
for UBE2C gene

Genomic Variants
for UBE2C gene

Disorders / Diseases
for UBE2C gene

Publications
for UBE2C gene

Intellectual Property
for UBE2C gene

Products
for UBE2C gene