Aliases for UBE2C Gene
Aliases for UBE2C Gene
- Ubiquitin Conjugating Enzyme E2 C 2 3 5
- (E3-Independent) E2 Ubiquitin-Conjugating Enzyme C 3 4
- E2 Ubiquitin-Conjugating Enzyme C 3 4
- Ubiquitin-Protein Ligase C 3 4
- UBCH10 3 4
- Mitotic-Specific Ubiquitin-Conjugating Enzyme 3
- Cyclin-Selective Ubiquitin Carrier Protein 3
- Ubiquitin-Conjugating Enzyme E2 C 3
External Ids for UBE2C Gene
- HGNC: 15937
- Entrez Gene: 11065
- Ensembl: ENSG00000175063
- OMIM: 605574
- UniProtKB: O00762
Previous GeneCards Identifiers for UBE2C Gene
- GC20P044169
- GC20P045079
- GC20P045126
- GC20P043874
- GC20P044442
- GC20P041183
Summaries for UBE2C Gene
-
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013]
GeneCards Summary for UBE2C Gene
UBE2C (Ubiquitin Conjugating Enzyme E2 C) is a Protein Coding gene. Among its related pathways are Immune System and Regulation of activated PAK-2p34 by proteasome mediated degradation. GO annotations related to this gene include ligase activity and ubiquitin protein ligase binding. An important paralog of this gene is UBE2U.
UniProtKB/Swiss-Prot for UBE2C Gene
-
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-11- and Lys-48-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating Lys-11-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for UBE2C Gene
Genomics for UBE2C Gene
Regulatory Elements for UBE2C Gene
Enhancers for UBE2C Gene
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around UBE2C on UCSC Golden Path with GeneCards custom track
- Transcription factor binding sites by QIAGEN in the UBE2C gene promoter:
Regulatory Element Products
Genomic Location for UBE2C Gene
- Chromosome:
- 20
- Start:
- 45,812,576 bp from pter
- End:
- 45,816,957 bp from pter
- Size:
- 4,382 bases
- Orientation:
- Plus strand
Genomic View for UBE2C Gene
Genes around UBE2C on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 20q13.12 by Ensembl
- 20q13.12 by Entrez Gene
- 20q13.12 by HGNC
UBE2C Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for UBE2C Gene
Proteins for UBE2C Gene
-
Protein details for UBE2C Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- O00762-UBE2C_HUMAN
- Recommended name:
- Ubiquitin-conjugating enzyme E2 C
- Protein Accession:
- O00762
- A6NP33
- E1P5N7
- G3XAB7
Protein attributes for UBE2C Gene
- Size:
- 179 amino acids
- Molecular mass:
- 19652 Da
- Quaternary structure:
-
- Component of the APC/C complex.
Three dimensional structures from OCA and Proteopedia for UBE2C Gene
Protein Expression for UBE2C Gene
Selected DME Specific Peptides for UBE2C Gene
- O00762:
-
- VGKRLQQELMTLMMSGDKGISAFPESDNLFKW
- QSLLGEPN
- ICLDILK
- GTVYEDLRYKLSLEFPSGYPYNAPTVKF
Post-translational modifications for UBE2C Gene
- Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates have been destroyed.
- Ubiquitination at Lys 80 and Lys 121
- Modification sites at PhosphoSitePlus
Other Protein References for UBE2C Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- EMD Millipore Complete listing of Mono and Polychlonal Antibodies for UBE2C
- R&D Systems Antibodies for UBE2C (UbcH10/UBE2C)
- Cell Signaling Technology (CST) Antibodies for UBE2C (UBE2C)
-
Custom Antibody ServicesOriGene Antibodies for UBE2C
- Novus Biologicals Antibodies for UBE2C
-
Cloud-Clone Corp. Antibodies for UBE2C
- Invitrogen Antibodies for UBE2C
- antibodies-online Antibodies for UBE2C: See all 111
- GeneTex UBE2C antibody for UBE2C
-
St John's Laboratory Antibodies for UBE2C
-
Santa Cruz Biotechnology (SCBT) Antibodies for UBE2C
Protein Products
- EMD Millipore Purified and/or Recombinant UBE2C Protein
- R&D Systems Proteins and Enzymes for UBE2C (UbcH10/UBE2C)
- Enzo Life Sciences proteins for UBE2C
- Search Origene for MassSpec and Protein Over-expression Lysates for UBE2C
- Origene Custom Protein Services for UBE2C
- ProSpec Recombinant Proteins for UBE2C
-
Cloud-Clone Corp. Proteins for UBE2C
- antibodies-online Proteins for UBE2C: See all 41
- Search antibodies-online for peptides
- Search GeneTex for Proteins for UBE2C
Domains & Families for UBE2C Gene
Gene Families for UBE2C Gene
Protein Domains for UBE2C Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for UBE2C Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
O00762- Family:
-
- Belongs to the ubiquitin-conjugating enzyme family.
Function for UBE2C Gene
Molecular function for UBE2C Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.
- UniProtKB/Swiss-Prot CatalyticActivity:
- S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.
- UniProtKB/Swiss-Prot Function:
- Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-11- and Lys-48-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating Lys-11-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
Enzyme Numbers (IUBMB) for UBE2C Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004842 | contributes_to ubiquitin-protein transferase activity | IDA | 18485873 |
| GO:0005515 | protein binding | IPI | 19822757 |
| GO:0005524 | ATP binding | IEA | -- |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0031625 | ubiquitin protein ligase binding | IBA | -- |
Phenotypes for UBE2C Gene
- MGI mutant phenotypes for UBE2C:
- inferred from 1 alleles
- GenomeRNAi human phenotypes for UBE2C:
-
- Increased vaccinia virus (VACV) infection
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased NF-kappaB reporter expression
- Decreased IL-8 secretion
- Synthetic lethal with MLN4924 (a NAE inhibitor)
- Increased viability with TRAIL
- Upregulation of Wnt/beta-catenin pathway after WNT3A stimulation
- Increased cilium length after serum starvation
- Decreased HIV-1 infection
Animal Models for UBE2C Gene
- MGI Knock Outs for UBE2C:
-
- Ube2c tm1.1(KOMP)Wtsi
Animal Model Products
-
Taconic Biosciences Mouse Models for UBE2C
- Cyagen custom Knockout/knockin (KOKI) mouse models for UBE2C
-
-
ViGene Biosciences ready-to-package AAV shRNAs for UBE2C gene
- Search ViGene Biosciences for UBE2C
CRISPR Products
-
OriGene CRISPR knockouts for UBE2C
- GenScript: Design CRISPR guide RNA sequences for UBE2C
miRNA for UBE2C Gene
- miRTarBase miRNAs that target UBE2C
miRNA Products
- Search ViGene Biosciences for UBE2C
Clone Products
- Sino Biological Human cDNA Clone for UBE2C
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for UBE2C
- VectorBuilder custom plasmid, inducible vectors for UBE2C
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for UBE2C
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
Horizon Cell Lines for UBE2C
-
ViGene Biosciences ready-to-package AAV shRNAs for UBE2C gene
Flow Cytometry Products
- eBioscience FlowRNA Probe Sets (VA1-10346) for UBE2C
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for UBE2C Gene
Localization for UBE2C Gene
| Compartment | Confidence |
|---|---|
| plasma membrane | 5 |
| nucleus | 5 |
| cytosol | 5 |
| mitochondrion | 1 |
| peroxisome | 1 |
| endoplasmic reticulum | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005654 | nucleoplasm | TAS | -- |
| GO:0005680 | anaphase-promoting complex | IDA | 18485873 |
| GO:0005737 | cytoplasm | IBA | -- |
| GO:0005829 | cytosol | TAS | -- |
No data available for Subcellular locations from UniProtKB/Swiss-Prot for UBE2C Gene
Pathways & Interactions for UBE2C Gene
| SuperPathway | Contained pathways | ||
|---|---|---|---|
| 1 | Regulation of activated PAK-2p34 by proteasome mediated degradation | ||
| 2 | APC-Cdc20 mediated degradation of Nek2A | ||
| 3 | Class I MHC mediated antigen processing and presentation | ||
| 4 | Cell Cycle, Mitotic |
.83
|
.60
|
| 5 | Cellular Senescence | ||
Pathways by source for UBE2C Gene
1 Cell Signaling Technology pathway for UBE2C Gene
2 BioSystems pathways for UBE2C Gene
1 KEGG pathway for UBE2C Gene
1 R&D Systems pathway for UBE2C Gene
3 Qiagen pathways for UBE2C Gene
UniProtKB/Swiss-Prot O00762-UBE2C_HUMAN
- Pathway: Protein modification; protein ubiquitination.
Interacting Proteins for UBE2C Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006511 | ubiquitin-dependent protein catabolic process | IDA | 9122200 |
| GO:0007049 | cell cycle | IEA | -- |
| GO:0007067 | mitotic nuclear division | IEA | -- |
| GO:0010458 | exit from mitosis | IMP | 19822757 |
| GO:0010994 | free ubiquitin chain polymerization | IDA | 19822757 |
No data available for SIGNOR curated interactions for UBE2C Gene
Drugs & Compounds for UBE2C Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| pyrophosphate |
|
14000-31-8 |
|
(1) ApexBio Compounds for UBE2C Gene
| Compound | Action | Cas Number |
|---|---|---|
| NSC697923 | Inhibitor of E2 complex Ubc13-Uev1A,cell permeable and selective | 343351-67-7 |
Drug Products
- ApexBio compounds for UBE2C
Transcripts for UBE2C Gene
mRNA/cDNA for UBE2C Gene
- (8) REFSEQ mRNAs :
- (11) Additional mRNA sequences :
- (252) Selected AceView cDNA sequences:
- (8) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for UBE2C Gene
CRISPR Products
-
OriGene CRISPR knockouts for UBE2C
- GenScript: Design CRISPR guide RNA sequences for UBE2C
miRNA Products
- Search ViGene Biosciences for UBE2C
Clone Products
- Sino Biological Human cDNA Clone for UBE2C
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Addgene plasmids for UBE2C
- VectorBuilder custom plasmid, inducible vectors for UBE2C
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for UBE2C
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Flow Cytometry Products
- eBioscience FlowRNA Probe Sets (VA1-10346) for UBE2C
| ExUns: | 1a | · | 1b | ^ | 2a | · | 2b | ^ | 3a | · | 3b | ^ | 4a | · | 4b | ^ | 5 | ^ | 6a | · | 6b |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | ||||||||||||||||||
| SP2: | - | - | - | ||||||||||||||||||
| SP3: | - | - | - | - | |||||||||||||||||
| SP4: | - | - | - | - | |||||||||||||||||
| SP5: | - | - | - | - | |||||||||||||||||
| SP6: | - | ||||||||||||||||||||
| SP7: | - | - | - | - | - | ||||||||||||||||
| SP8: |
Expression for UBE2C Gene
mRNA expression in embryonic tissues and stem cells from LifeMap Discovery
- Blood (Cardiovascular System)
-
Thymus (Hematopoietic System)
- Double Negative 2 Thymocytes Thymus
mRNA differential expression in normal tissues according to GTEx for UBE2C Gene
This gene is overexpressed in Esophagus - Mucosa (x5.0).
This gene is overexpressed in Bone (41.7) and Stomach (8.7).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for UBE2C Gene
NURSA nuclear receptor signaling pathways regulating expression of UBE2C Gene:
UBE2CSOURCE GeneReport for Unigene cluster for UBE2C Gene:
Hs.93002Primer Products
-
OriGene qPCR primer pairs for UBE2C
-
OriGene qPCR primer pairs and template standards for UBE2C
No data available for mRNA Expression by UniProt/SwissProt for UBE2C Gene
Orthologs for UBE2C Gene
This gene was present in the common ancestor of eukaryotes.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | -- 35 |
|
OneToMany | |
| -- 35 |
|
OneToMany | |||
| UBE2C 34 |
|
||||
| dog (Canis familiaris) |
Mammalia | UBE2C 34 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | UBE2C 35 |
|
OneToOne | |
| cow (Bos Taurus) |
Mammalia | UBE2C 34 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | Ube2c 34 |
|
||
| mouse (Mus musculus) |
Mammalia | Ube2c 34 16 35 |
|
||
| platypus (Ornithorhynchus anatinus) |
Mammalia | UBE2C 35 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | UBE2C 34 35 |
|
||
| tropical clawed frog (Silurana tropicalis) |
Amphibia | ube2c 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | ube2c 34 35 |
|
||
| rainbow trout (Oncorhynchus mykiss) |
Actinopterygii | Omy.8806 34 |
|
||
| fruit fly (Drosophila melanogaster) |
Insecta | vihar 36 |
|
|
|
| vih 34 35 |
|
||||
| African malaria mosquito (Anopheles gambiae) |
Insecta | AgaP_AGAP006238 34 |
|
||
| baker's yeast (Saccharomyces cerevisiae) |
Saccharomycetes | UBC11 34 35 37 |
|
||
| thale cress (Arabidopsis thaliana) |
eudicotyledons | UBC19 34 |
|
||
| Alicante grape (Vitis vinifera) |
eudicotyledons | Vvi.9379 34 |
|
||
| rice (Oryza sativa) |
Liliopsida | Os01g0273100 34 |
|
||
| Os.247 34 |
|
||||
| barley (Hordeum vulgare) |
Liliopsida | Hv.2165 34 |
|
||
| wheat (Triticum aestivum) |
Liliopsida | Ta.3436 34 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | CSA.3903 35 |
|
OneToOne | |
| fission yeast (Schizosaccharomyces pombe) |
Schizosaccharomycetes | ubc11 34 |
|
||
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.5287 34 |
|
- Species where no ortholog for UBE2C was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African clawed frog (Xenopus laevis)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- lizard (Anolis carolinensis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- worm (Caenorhabditis elegans)
Paralogs for UBE2C Gene
(23) SIMAP similar genes for UBE2C Gene using alignment to 3 proteins:
Pseudogenes.org Pseudogenes for UBE2C Gene
Variants for UBE2C Gene
| SNP ID | Clin | Chr 20 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs10644382 | -- | 45,813,659(+) | ATCTC(-/TA)GAACA | intron-variant | |
| rs10644383 | -- | 45,814,128(+) | CTCAA(-/TC/TCTC/TCTCTC)TCTCT | intron-variant | |
| rs11086982 | -- | 45,813,687(+) | AAGAC(C/T)CTCCC | intron-variant | |
| rs111714378 | -- | 45,812,286(+) | CCCGA(A/G)GGAAA | upstream-variant-2KB | |
| rs112244940 | -- | 45,814,995(+) | ACCAC(A/G)CCCGG | intron-variant |
Residual Variation Intolerance Score:
40.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
3.85;
58.81% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for UBE2C Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- UBE2C
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for UBE2C Gene
Disorders for UBE2C Gene
Relevant External Links for UBE2C
No disorders were found for UBE2C Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for UBE2C Gene
Publications for UBE2C Gene
- Dominant-negative cyclin-selective ubiquitin carrier protein E2- C/UbcH10 blocks cells in metaphase. (PMID: 9122200) Townsley F.M. … Ruderman J.V. (Proc. Natl. Acad. Sci. U.S.A. 1997) 2 3 4 22 64
- The E2 ubiquitin-conjugating enzymes direct polyubiquitination to preferred lysines. (PMID: 20061386) David Y. … Navon A. (J. Biol. Chem. 2010) 3 4 64
- Overexpression of the E2 ubiquitin-conjugating enzyme UbcH10 causes chromosome missegregation and tumor formation. (PMID: 20065091) van Ree J.H. … van Deursen J.M. (J. Cell Biol. 2010) 3 22 64
- Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey S.D. … Anand S. (Diabetes Care 2010) 3 46 64
- Knockdown of ubiquitin-conjugating enzyme E2C/UbcH10 expression by RNA interference inhibits glioma cell proliferation and enhances cell apoptosis in vitro. (PMID: 19657671) Jiang L. … Lu Y. (J. Cancer Res. Clin. Oncol. 2010) 3 22 64
Products for UBE2C Gene
- Browse Small Molecules at EMD Millipore
- EMD Millipore Complete listing of Mono and Polychlonal Antibodies for UBE2C
- EMD Millipore Purified and/or Recombinant UBE2C Protein
- Browse Kits and Assays available from EMD Millipore
- EMD Millipore genomic analysis products
- R&D Systems Antibodies for UBE2C (UbcH10/UBE2C)
- R&D Systems Proteins and Enzymes for UBE2C (UbcH10/UBE2C)
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody ServicesOriGene Antibodies for UBE2C
- Browse OriGene ELISA Kits
- Custom Assay Services
- Search Origene for MassSpec and Protein Over-expression Lysates for UBE2C
- Origene Custom Protein Services for UBE2C
- Origene rat_shrna, siRNA, shRNA, mouse_rna, and RNAi products in human, mouse, rat for UBE2C
- Browse OriGene Inhibitory RNA Products For UBE2C
- OriGene qPCR primer pairs and template standards for UBE2C
- OriGene qPCR primer pairs for UBE2C
- OriGene CRISPR knockouts for UBE2C
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For UBE2C
- GenScript: Next-day shipping cDNA clones in your preferred vector
- GenScript Purified and Recombinant Proteins for UBE2C
- GenScript Custom Purified and Recombinant Proteins Services for UBE2C
- GenScript Custom Assay Services for UBE2C
- GenScript Custom overexpressing Cell Line Services for UBE2C
- GenScript: Design CRISPR guide RNA sequences for UBE2C
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for UBE2C
- Cell Signaling Technology (CST) Antibodies for UBE2C (UBE2C)
- Search for Antibodies & Assays
- Sino Biological Human cDNA Clone for UBE2C
- Browse Sino Biological Cell Lysates
- Browse Sino Biological Proteins
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for UBE2C
- Novus Biologicals proteins and lysates for UBE2C
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- ProSpec Recombinant Proteins for UBE2C
- Cloud-Clone Corp. Antibodies for UBE2C
- Cloud-Clone Corp. Proteins for UBE2C
- Cloud-Clone Corp Assay Kits for UBE2C
- Taconic Biosciences Mouse Models for UBE2C
- Find your next knockout model in the Taconic Knockout Repository
- Genetically Engineered Models Available Immediately
- Humanized Mice
- Invitrogen Antibodies for UBE2C
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- ApexBio compounds for UBE2C
- Addgene plasmids for UBE2C
- antibodies-online Antibodies for UBE2C: See all 111
- antibodies-online Kits for UBE2C: See all 8
- antibodies-online Proteins for UBE2C: See all 41
- Search antibodies-online for peptides
- GeneTex UBE2C antibody for UBE2C
- Search GeneTex for Proteins for UBE2C
- ViGene Biosciences ready-to-package AAV shRNAs for UBE2C gene
- Search ViGene Biosciences for UBE2C
- Santa Cruz Biotechnology (SCBT) Antibodies for UBE2C
- Search Santa Cruz Biotechnology (SCBT) for UBE2C siRNA/shRNA
- Browse Santa Cruz Biotechnology (SCBT) for UBE2C CRISPR
- Horizon Cell Lines for UBE2C
- Cyagen custom Knockout/knockin (KOKI) mouse models for UBE2C
- VectorBuilder custom plasmid, inducible vectors for UBE2C
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for UBE2C
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for UBE2C Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab