Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

UBE2C Gene

protein-coding   GIFtS: 68
GCID: GC20P044442

Ubiquitin-Conjugating Enzyme E2C
  See related diseases
at
MalaCards
 

Aliases
for UBE2C gene

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section
Aliases
Ubiquitin-Conjugating Enzyme E2C1 2     dJ447F3.22
UBCH102 3 5     Mitotic-Specific Ubiquitin-Conjugating Enzyme2
Ubiquitin-Protein Ligase C2 3     Ubiquitin-Conjugating Enzyme E2 C2
EC 6.3.2.193 8     UbcH103
Cyclin-Selective Ubiquitin Carrier Protein2     Ubiquitin Carrier Protein C3

External Ids:    HGNC: 159371   Entrez Gene: 110652   Ensembl: ENSG000001750637   OMIM: 6055745   UniProtKB: O007623   

Export aliases for UBE2C gene to outside databases

Previous GC identifers: GC20P044169 GC20P045079 GC20P045126 GC20P043874 GC20P041183


Summaries
for UBE2C gene

(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section
Entrez Gene summary for UBE2C Gene:
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or
short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes:
ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a
member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of
mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript
variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on
chromosomes 4, 14, 15, 18, and 19. (provided by RefSeq, Aug 2013)

GeneCards Summary for UBE2C Gene: 
UBE2C (ubiquitin-conjugating enzyme E2C) is a protein-coding gene. Diseases associated with UBE2C include esophageal adenocarcinoma, and papillary thyroid carcinoma, and among its related super-pathways are Mitotic Spindle Checkpoint and Antigen processing: Ubiquitination & Proteasome degradation. GO annotations related to this gene include ubiquitin-protein ligase activity and ATP binding. An important paralog of this gene is ENSG00000258677.

UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762
Function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro
catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting
complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis.
Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C
substrates by the proteasome and promoting mitotic exit

Gene Wiki entry for UBE2C Gene


Genomic Views
for UBE2C gene

(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 73), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000020.10  NT_011362.10  NC_018931.2  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the UBE2C gene promoter:
         c-Rel   Pax-2   CP1A   CP1C   Pax-2a   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): UBE2C promoter sequence
   Search SABiosciences Chromatin IP Primers for UBE2C

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat UBE2C


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 20q13.12   Ensembl cytogenetic band:  20q13.12   HGNC cytogenetic band: 20q13.12

UBE2C Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
UBE2C gene location

GeneLoc information about chromosome 20         GeneLoc Exon Structure

GeneLoc location for GC20P044442:  view genomic region     (about GC identifiers)

Start:
 44,441,215 bp from pter      End:
 44,445,596 bp from pter
Size:
 4,382 bases      Orientation:
 plus strand

Proteins
for UBE2C gene

(According to UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MAXQB RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Ontologies according to Gene Ontology Consortium 01 Oct 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section
UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762 (See protein sequence)
Recommended Name: Ubiquitin-conjugating enzyme E2 C  
Size: 179 amino acids; 19652 Da
Subunit: Component of the APC/C complex
1 PDB 3D structure from and Proteopedia for UBE2C:
1I7K (3D)    
Secondary accessions: A6NP33 E1P5N7 G3XAB7
Alternative splicing: 4 isoforms:  O00762-1   O00762-2   O00762-3   O00762-4   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for UBE2C: NX_O00762

Explore proteomics data for UBE2C at MOPED 

Post-translational modifications:

  • UniProtKB: Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a
    central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit
    the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates
    have been destroyed
  • View modification sites using PhosphoSitePlus
  • View neXtProt modification sites for NX_O00762

    • 4 DME Specific Peptides for UBE2C (O00762)
     ICLDILK  QSLLGEPN  GTVYEDLRYKLSLEFPSGYPYNAPTVKF  VGKRLQQELMTLMMSGDKGISAFPESDNLFKW 

    UBE2C Protein expression data from MOPED1, PaxDb2 and MAXQB3 :    About this image 

    UBE2C Protein Expression
    REFSEQ proteins (8 alternative transcripts): 
    NP_001268670.1  NP_001268671.1  NP_008950.1  NP_861515.1  NP_861516.1  NP_861517.1  NP_861518.1  NP_861519.1  

    ENSEMBL proteins: 
     ENSP00000348838   ENSP00000335674   ENSP00000243893   ENSP00000333975   ENSP00000361649  
     ENSP00000385878  
    Reactome Protein details: O00762
    Human Recombinant Protein Products for UBE2C: 
    EMD Millipore Purified and/or Recombinant UBE2C Protein
    R&D Systems Recombinant & Natural Proteins for UBE2C (UbcH10/UBE2C)
    Enzo Life Sciences proteins for UBE2C
    OriGene Purified Proteins for UBE2C
    OriGene Protein Over-expression Lysate for UBE2C
    OriGene MassSpec for UBE2C 
    OriGene Custom Protein Services for UBE2C
    GenScript Purified and Recombinant Proteins for UBE2C
    Novus Biologicals UBE2C Proteins
    Novus Biologicals UBE2C Lysates
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates 
    ProSpec Recombinant Protein for UBE2C
    Cloud-Clone Corp. Proteins for UBE2C 

    Gene Ontology (GO): 3 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005654nucleoplasm TAS--
    GO:0005680anaphase-promoting complex IDA18485873
    GO:0005829cytosol TAS--

    UBE2C for ontologies           About GeneDecksing



    UBE2C Antibody Products: 
    EMD Millipore Mono- and Polyclonal Antibodies for the study of UBE2C
    R&D Systems Antibodies for UBE2C (UbcH10/UBE2C)
    OriGene Antibodies for UBE2C
    OriGene Custom Antibody Services for UBE2C
    GenScript Custom Superior Antibodies Services for UBE2C
    Novus Biologicals UBE2C Antibodies
    Abcam antibodies for UBE2C
    Cloud-Clone Corp. Antibodies for UBE2C 
    ThermoFisher Antibodies for UBE2C
    LSBio Antibodies in human, mouse, rat for UBE2C 

    Assay Products for UBE2C: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for UBE2C
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for UBE2C
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for UBE2C 
    Cloud-Clone Corp. CLIAs for UBE2C

    Protein Domains /
    Families
    for UBE2C gene

    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section
    		 HGNC Gene Families: 
    UBE2: Ubiquitin-conjugating enzymes E2

    3 InterPro protein domains:
     IPR016135 UBQ-conjugating_enzyme/RWD
     IPR023313 UBQ-conjugating_AS
     IPR000608 UBQ-conjugat_E2

    Graphical View of Domain Structure for InterPro Entry O00762

    ProtoNet protein and cluster: O00762

    1 Blocks protein domain: IPB000608 Ubiquitin-conjugating enzymes

    UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762
    Similarity: Belongs to the ubiquitin-conjugating enzyme family


    UBE2C for domains           About GeneDecksing


    Function
    for UBE2C gene

    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase, shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Sirion Biotech, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, Vector BioLabs, and Sirion Biotech, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene.)
    About This Section
    Molecular Function:

         UniProtKB/Swiss-Prot Summary: UBE2C_HUMAN, O00762
    Function: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro
    catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting
    complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis.
    Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C
    substrates by the proteasome and promoting mitotic exit
    Catalytic activity: ATP + ubiquitin + protein lysine = AMP + diphosphate + protein N-ubiquityllysine

         Enzyme Number (IUBMB): EC 6.3.2.191 2

         Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004842contributes to ubiquitin-protein ligase activity IDA18485873
    GO:0005515protein binding IPI19822757
    GO:0005524ATP binding IEA--
    GO:0016881acid-amino acid ligase activity ----
         
    UBE2C for ontologies           About GeneDecksing


    Phenotypes:
         3 GenomeRNAi human phenotypes for UBE2C:
     Decreased cilium length after   Decreased viability  Upregulation of Wnt/beta-caten 

         1 MGI phenotypic allele for Ube2c (no phenotypes)

    UBE2C for phenotypes           About GeneDecksing

    Animal Models:
         MGI mouse knock-out Ube2ctm1(KOMP)Wtsi for UBE2C

       inGenious Targeting Laboratory - Custom generated mouse model solutions for UBE2C 
       inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for UBE2C

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for UBE2C 
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for UBE2C 

    miRNA
    Products:            		QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat UBE2C
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate UBE2C
    SwitchGear 3'UTR luciferase reporter plasmid: UBE2C 3' UTR sequence
    Inhib. RNA
    Products:            		Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for UBE2C
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat UBE2C

    Gene Editing
    Products:    		DNA2.0 Custom Protein Engineering Service for UBE2C
    Sirion Biotech Customized adenovirus for overexpression of UBE2C

    Clone
    Products:             		Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene clones in human, mouse for UBE2C (see all 31)
    OriGene ORF clones in mouse, rat for UBE2C
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector (see all 6): UBE2C (NM_007019)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2C
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2C
    Sirion Biotech Customized lentivirus for stable overexpression of UBE2C 
                         Customized lentivirus expression plasmids for stable overexpression of UBE2C 

    Cell Line
    Products:             		GenScript Custom overexpressing Cell Line Services for UBE2C
    Search LifeMap BioReagents cell lines for UBE2C
    In Situ Assay
    Products:       
         		Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2C


    Pathways & Interactions
    for UBE2C gene

    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene).
    About This Section

    SuperPaths for UBE2C About   (see all 11)                                                                                              See pathways by source

    SuperPathSelected contained pathways About (see all per SuperPath)
    1Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
    		Mitotic Spindle Checkpoint0.95
    		APC/C:Cdc20 mediated degradation of Cyclin B0.76
    		Inactivation of APC/C via direct inhibition of the APC/C complex0.95
    		Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase0.75
    		Inhibition of the proteolytic activity of APC/C required for the onset of anaphase by mitotic spindle checkpoint components0.95
    		Phosphorylation of the APC/C0.73
    		APC-Cdc20 mediated degradation of Nek2A0.78
    		Common schema of ubiquitination0.36
    2Antigen processing: Ubiquitination & Proteasome degradation
    		Antigen processing: Ubiquitination & Proteasome degradation0.83
    		Ubiquitin mediated proteolysis0.36
    		Class I MHC mediated antigen processing & presentation0.83
    3CDK-mediated phosphorylation and removal of Cdc6
    		APC/C:Cdc20 mediated degradation of mitotic proteins0.94
    		Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins0.93
    		Cdc20:Phospho-APC/C mediated degradation of Cyclin A0.94
    		APC/C:Cdc20 mediated degradation of Securin0.93
    		Regulation of APC/C activators between G1/S and early anaphase0.94
    		APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G10.93
    		APC/C-mediated degradation of cell cycle proteins0.94
    		Autodegradation of Cdh1 by Cdh1:APC/C0.91
    4M Phase
    		Mitotic Anaphase0.94
    		M Phase0.88
    		Separation of Sister Chromatids0.94
    		Mitotic M-M/G1 phases0.88
    		Mitotic Metaphase and Anaphase0.94
    5Cell Cycle
    		Cell Cycle, Mitotic0.84
    		Cell Cycle0.84

    Pathways by source                                                                                                                                                                 See SuperPaths
    Show all pathways

    1 EMD Millipore Pathway for UBE2C
        Common schema of ubiquitination

    3 Downloadable PowerPoint Slides of QIAGEN Pathway Central Maps for UBE2C
        Ubiquitin-Proteasome Dependent Proteolysis
    Remodeling of Adherens Junctions
    SOCS Pathway

    2 BioSystems Pathways for UBE2C
        Gastric cancer network 1
    Gastric cancer network 2

    5/28        Reactome Pathways for UBE2C (see all 28)
        APC/C:Cdc20 mediated degradation of mitotic proteins
    Cell Cycle
    M Phase
    Phosphorylation of the APC/C
    Mitotic Spindle Checkpoint


    1         Kegg Pathway  (Kegg details for UBE2C):
        Ubiquitin mediated proteolysis

    UniProtKB/Swiss-Prot: UBE2C_HUMAN, O00762
    Pathway: Protein modification; protein ubiquitination


    UBE2C for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for UBE2C

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/105 Interacting proteins for UBE2C (O007623 ENSP000003488384) via UniProtKB, MINT, STRING, and/or I2D (see all 105)

    InteractantInteraction Details
    GeneCardExternal ID(s)
    ANAPC11Q9NYG53, ENSP000003499574I2D: score=1 STRING: ENSP00000349957
    PCGF3Q3KNV83, ENSP000003547244I2D: score=1 STRING: ENSP00000354724
    POLMQ9NP873, ENSP000002422484I2D: score=1 STRING: ENSP00000242248
    RANBP9Q96S593, ENSP000000116194I2D: score=1 STRING: ENSP00000011619
    UBASH3BQ8TF423, ENSP000002842734I2D: score=1 STRING: ENSP00000284273
    About this table

    Gene Ontology (GO): 5/19 biological process terms (GO ID links to tree view) (see all 19):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000278mitotic cell cycle TAS--
    GO:0006511ubiquitin-dependent protein catabolic process IDA18485873
    GO:0007049cell cycle NAS15504738
    GO:0007051spindle organization NAS15504738
    GO:0007094mitotic spindle assembly checkpoint TAS--

    UBE2C for ontologies           About GeneDecksing



    Drugs & Compounds
    for UBE2C gene

    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    UBE2C for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for UBE2C

    4 HMDB Compounds for UBE2C    About this table
    CompoundSynonyms CAS #PubMed Ids
    Adenosine monophosphate5'-AMP (see all 28)61-19-8--
    Adenosine triphosphate5'-(tetrahydrogen triphosphate) Adenosine (see all 24)56-65-5--
    Phosphoric acidacide phosphorique (FRENCH) (see all 20)7664-38-2--
    Pyrophosphate(4-)Diphosphoric acid ion (see all 10)14000-31-8--

    2 Novoseek inferred chemical compound relationships for UBE2C gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    lysine 19.1 1 14732013 (1)
    oligonucleotide 11.8 1 17217624 (1)

    Search CenterWatch for drugs/clinical trials and news about UBE2C

    Transcripts
    for UBE2C gene

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Sirion Biotech, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section
    REFSEQ mRNAs for UBE2C gene (8 alternative transcripts): 
    NM_001281741.1  NM_001281742.1  NM_007019.3  NM_181799.2  NM_181800.2  NM_181801.3  NM_181802.1  NM_181803.1  

    Unigene Cluster for UBE2C:

    Ubiquitin-conjugating enzyme E2C
    Hs.93002  [show with all ESTs]
    Unigene Representative Sequence: BC032677
    7 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000356455(uc002xpm.3 uc002xpo.3 uc002xpp.3) ENST00000335046(uc002xpl.3)
    ENST00000243893 ENST00000352551 ENST00000372568(uc002xpq.3) ENST00000496085
    ENST00000405520(uc002xpn.3)
    miRNA
    Products:             		 QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat UBE2C
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate UBE2C
    SwitchGear 3'UTR luciferase reporter plasmid: UBE2C 3' UTR sequence
    Inhib. RNA
    Products:             		Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for UBE2C
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat UBE2C
    Clone
    Products:             		 OriGene clones in human, mouse for UBE2C (see all 31)
    OriGene ORF clones in mouse, rat for UBE2C
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector (see all 6): UBE2C (NM_007019)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for UBE2C
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2C
    Sirion Biotech Customized lentivirus for stable overexpression of UBE2C 
                         Customized lentivirus expression plasmids for stable overexpression of UBE2C 
    Primer
    Products:            		OriGene qPCR primer pairs and template standards for UBE2C
    OriGene qSTAR qPCR primer pairs in human, mouse for UBE2C
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat UBE2C
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat UBE2C
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat UBE2C

    Additional mRNA sequence: 

    AK311949.1 BC007656.2 BC016292.1 BC028161.1 BC032677.2 BC050736.1 BT007300.1 BT020165.1 
    BT020166.1 CR456988.1 U73379.1 

    17 DOTS entries:

    DT.455083  DT.446076  DT.101984847  DT.91766689  DT.95092516  DT.101984846  DT.100822418  DT.120817240 
    DT.120817711  DT.102842123  DT.102842126  DT.120817606  DT.102842114  DT.120817859  DT.95189185  DT.95245584 
    DT.100038110 

    24/252 AceView cDNA sequences (see all 252):

    BU506804 BX344527 NM_181802 AW016092 AI264541 BU509084 AI650374 BE268039 
    BM698699 CR610834 BM557700 BM549174 BG339467 NM_181800 BC007656 NM_181799 
    BM803682 BE904898 BM758823 AA315182 BM556795 BM467729 BM423477 BC050736 

    GeneLoc Exon Structure

    5/8 Alternative Splicing Database (ASD) splice patterns (SP) for UBE2C (see all 8)    About this scheme

    ExUns: 1a · 1b ^ 2a · 2b ^ 3a · 3b ^ 4a · 4b ^ 5 ^ 6a · 6b
    SP1:                    -     -           -                           
    SP2:                    -     -                 -                     
    SP3:                    -     -           -     -                     
    SP4:                    -     -     -           -                     
    SP5:                    -     -     -     -                           


    ECgene alternative splicing isoforms for UBE2C

    Expression
    for UBE2C gene

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    UBE2C expression in normal human tissues (normalized intensities)      UBE2C embryonic expression: see
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: CTGCCGAGCT
    UBE2C Expression
    About this image


    UBE2C expression in embryonic tissues and stem cells    About this table
    Data from LifeMap, the Embryonic Development and Stem Cells Database 
     5/14 selected tissues (see all 14) fully expand
     
     Blood (Cardiovascular System)    fully expand to see all 2 entries
             Double Negative 2 Thymocytes Thymus
             Bone marrow-derived hematopoietic stem cells
     
     Smooth Muscle (Muscoskeletal System)
             Human Intestinal Smooth Muscle Cells (HISMC)   
     
     Thymus (Hematopoietic System)
             Double Negative 2 Thymocytes Thymus
     
     Peripheral Nervous System (Nervous System)
             Human Schwann Cells (HSC)   
     
     Bone (Muscoskeletal System)
             Human fetal bone marrow-derived mesenchymal stromal cells

    See UBE2C Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for UBE2C

    SOURCE GeneReport for Unigene cluster: Hs.93002
        SABiosciences Expression via Pathway-Focused PCR Array including UBE2C: 
              Ubiquitination (Ubiquitylation) Pathway in human mouse rat

    Primer
    Products:    		OriGene qPCR primer pairs and template standards for UBE2C
    OriGene qSTAR qPCR primer pairs in human, mouse for UBE2C
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat UBE2C
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat UBE2C
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat UBE2C
    In Situ
    Assay Products:     
         		Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2C

    Orthologs
    for UBE2C gene

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section
    This gene was present in the common ancestor of eukaryotes.

    Orthologs for UBE2C gene from 8/23 species (see all 23)    About this table
    Organism Taxonomic
    classification    		 Gene Description Human
    Similarity    		 Orthology
    Type    		 Details
    mouse
    (Mus musculus)    		 Mammalia Ube2c1 , 5 ubiquitin-conjugating enzyme E2C1, 5 87.52(n)1
    95.53(a)1    		   2 (85.27 cM)5
    686121  NM_026785.21  NP_081061.11 
     1647698985 
    chicken
    (Gallus gallus)    		 Aves LOC1008594131 ubiquitin-conjugating enzyme E2 C-like 78.41(n)
    88.57(a)    		   100859413  XM_003642470.1  XP_003642518.1 
    African clawed frog
    (Xenopus laevis)    		 Amphibia 480179322   -- 77.83(n)    48017932 
    zebrafish
    (Danio rerio)    		 Actinopterygii ube2c1 ubiquitin-conjugating enzyme E2C 68.64(n)
    76.92(a)    		   566441  NM_001037691.1  NP_001032780.1 
    fruit fly
    (Drosophila melanogaster)    		 Insecta vihar3
    vih1    		 ubiquitin conjugating enzyme3
    vihar1    		 66(a)3
    65.13(n)1
    66.45(a)1    		   69C43
    441181  NM_140325.21  NP_648582.11 
    baker's yeast
    (Saccharomyces cerevisiae)    		 Saccharomycetes UBC11(YOR339C)4
    UBC111    		 Ubiquitin-conjugating enzyme most similar in sequence more4
    Ubc11p1    		 56.25(n)1
    63.28(a)1    		   15(958832-958362)4
    8545171, 4  NP_014984.31  NP_014984.14 
    thale cress
    (Arabidopsis thaliana)    		 eudicotyledons UBC191 ubiquitin-conjugating enzyme E2 19 58.9(n)
    59.51(a)    		   821545  NM_112897.3  NP_566653.1 
    rice
    (Oryza sativa)    		 Liliopsida Os.2472 Oryza sativa (japonica cultivar-group) cDNA clone0 more 75.21(n)    AK105320.1 


    ENSEMBL Gene Tree for UBE2C (if available)
    TreeFam Gene Tree for UBE2C (if available)

    Paralogs
    for UBE2C gene

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for UBE2C gene
    ENSG000002586772  UBE2W2  
    18/22 SIMAP similar genes for UBE2C using alignment to 3 protein entries:     UBE2C_HUMAN (see all proteins) (see all similar genes):
    HR6A    UBE2A    UBE2U    UBE2B    UBE2H    UBE2D4
    UBE2K    UBE2N    UBE2D3    UBE2D2    UBE2D1    UBE2S
    UBE2M    UBE2E1    UBE2NL    UBE2W    UBE2E3    UBE2T

    UBE2C for paralogs           About GeneDecksing


    5 Pseudogenes.org Pseudogenes for UBE2C
    PGOHUM00000247755 PGOHUM00000247067 PGOHUM00000234895 PGOHUM00000250630 PGOHUM00000245919


    Genomic Variants
    for UBE2C gene

    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/183 SNPs in UBE2C are shown (see all 183)    About this table     
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance    		Chr 20 posSequence#AA
    Chg    		TypeMore#Allele
    freq    		PopTotal
    sample    		More
    ----------
    VAR_0076944
    		----see VAR_0076942 G D mis40--------
    rs1894151611,2
    		--44440630(+) CTGGTA/CTCGAA 6 -- us2k10--------
    rs81229731,2
    		C,F--44440635(+) ctcgaT/Actcct 6 -- us2k12Minor allele frequency- A:0.33WA CSA 3
    rs3686221,2
    		C,F,A,H--44440690(-) ACGTCT/CGTAAT 6 -- us2k115Minor allele frequency- C:0.15NS EA WA NA CSA 791
    rs60942131,2
    		H--44440726(+) ATGTTG/TCCTTT 6 -- us2k14Minor allele frequency- T:0.00NS EA 394
    rs731247411,2
    		C,F--44440737(+) TTTTAT/CTTCTG 6 -- us2k13Minor allele frequency- C:0.03NA WA 240
    rs739111131,2
    		C,F--44440990(+) AGAAGG/AAGGGG 6 -- us2k12Minor allele frequency- A:0.03WA 120
    rs1813039071,2
    		--44441088(+) CAGCAG/TCATCT 6 -- us2k10--------
    rs731247421,2
    		C,F--44441090(+) GCATCA/GTCTAC 6 -- us2k13Minor allele frequency- G:0.02NA WA 240
    rs1838159931,2
    		--44441175(+) AATAGA/GGCGCT 6 -- us2k10--------

    HapMap Linkage Disequilibrium report for UBE2C (44441215 - 44445596 bp)

    Structural Variations
         Database of Genomic Variants (DGV) 1 variation for UBE2C:    About this table     
    Variant IDTypeSubtypePubMed ID
    nsv833990CNV Loss17160897

    SABiosciences Cancer Mutation PCR Assays
    1 SABiosciences qBiomarker Copy Number PCR Array containing UBE2C:
    Ovarian Cancer
    SeqTarget long-range PCR primers for resequencing UBE2C
    DNA2.0 Custom Variant and Variant Library Synthesis for UBE2C

    Disorders / Diseases
    for UBE2C gene

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section
    		 OMIM gene information: 605574    OMIM disorders: --

    18 diseases for UBE2C:    About MalaCards
    esophageal adenocarcinoma    papillary thyroid carcinoma    intrahepatic cholangiocarcinoma    cholangiocarcinoma
    cervical cancer    neuroblastoma    thyroiditis    cervicitis
    colon cancer    lung cancer    hepatocellular carcinoma    colorectal cancer
    esophagitis    prostate cancer    prostatitis    adenocarcinoma
    gastric cancer    breast cancer


    UBE2C for disorders           About GeneDecksing

    3 Novoseek inferred disease relationships for UBE2C gene    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    primary tumor 15.8 2 16772118 (1)
    tumors 6.27 15 20065091 (4), 20099376 (4), 18331723 (1), 17217624 (1) (see all 6)
    metastasis 0 1 16772118 (1)

    Genetic Association Database (GAD): UBE2C
    Human Genome Epidemiology (HuGE) Navigator: UBE2C (3 documents)

    Export disorders for UBE2C gene to outside databases

    Publications
    for UBE2C gene

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for UBE2C gene, integrated from 9 sources (see all 128):
    (articles sorted by number of sources associating them with UBE2C)    		    Utopia: connect your pdf to the dynamic
    world of online information

    1. Dominant-negative cyclin-selective ubiquitin carrier protein E2- C/UbcH10 blocks cells in metaphase. (PubMed id 9122200)1, 2, 3, 9 Townsley F.M.... Ruderman J.V. (1997)
    2. Variation at the NFATC2 locus increases the risk of t hiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipr il and rosiglitazone Medication (DREAM) study. (PubMed id 20628086)1, 4 Bailey S.D....Anand S. (2010)
    3. Identification of a physiological E2 module for the human anaphase- promoting complex. (PubMed id 19822757)1, 2 Williamson A....Rape M. (2009)
    4. UBE2S elongates ubiquitin chains on APC/C substrates to promote mitotic exit. (PubMed id 19820702)1, 2 Garnett M.J.... Venkitaraman A.R. (2009)
    5. Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex. (PubMed id 18485873)1, 2 Jin L....Rape M. (2008)
    6. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    7. Structural and functional analysis of the human mitotic-specific ubiquitin-conjugating enzyme, UbcH10. (PubMed id 11927573)1, 2 Lin Y.... Basavappa R. (2002)
    8. The DNA sequence and comparative analysis of human chromosome 20. (PubMed id 11780052)1, 2 Deloukas P....Rogers J. (2001)
    9. Identification of overexpressed genes in hepatocellular carcinoma, with special reference to ubiquitin-conjugating enzyme E2C gene expression. (PubMed id 17354233)1, 9 Ieta K....Mori M. (2007)
    10. Expression and effect of inhibition of the ubiquitin-conjugating enzyme E2C on esophageal adenocarcinoma. (PubMed id 17217624)1, 9 Lin J....Lin L. (2006)

    External Searches for UBE2C gene

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  
      Query String
    		PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    Genome Databases showing UBE2C gene

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 11065 HGNC: 15937 AceView: UBE2C Ensembl:ENSG00000175063 euGenes: HUgn11065
    ECgene: UBE2C Kegg: 11065 H-InvDB: UBE2C

    Other Databases showing UBE2C gene

    (According to HUGE)
    About This Section
    		   --

    Specialized Databases showing UBE2C gene

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for UBE2C Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for UBE2C Genetics and Cytogenetics in Oncology and Haematology

    Intellectual Property
    for UBE2C gene

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    		Patent Information for UBE2C gene:
    Search GeneIP for patents involving UBE2C

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    Products
    for UBE2C gene

    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0 and Sirion Biotech, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Sirion Biotech, Cell lines from GenScript, and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

     Browse Kits and Assays available from EMD Millipore
     EMD Millipore Mono- and Polyclonal Antibodies for the study of UBE2C
     EMD Millipore Purified and/or Recombinant UBE2C Protein
     Browse Small Molecules at EMD Millipore
     Browse for Gene Knock-down Tools from EMD Millipore
     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Antibodies for UBE2C (UbcH10/UBE2C)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Protease Activity Assays and Reagents   Recombinant/Natural Proteins for UBE2C (UbcH10/UBE2C)  
     Browse Stem Cell Products   Browse Tocris Biochemicals & Compounds  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     OriGene Antibodies for UBE2C   OriGene RNAi products in human, mouse, rat for UBE2C  
     OriGene qPCR primer pairs and template standards for UBE2C   OriGene Protein Over-expression Lysate for UBE2C  
     OriGene MassSpec something-or-other for UBE2C   OriGene clones in human, mouse for UBE2C  
     OriGene qSTAR qPCR primer pairs in human, mouse for UBE2C   OriGene Purified Protein for UBE2C  
     OriGene ORF clones in mouse, rat for UBE2C   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for UBE2C   OriGene Custom Protein Services for UBE2C  

         		 
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat UBE2C
     QIAGEN SeqTarget long-range PCR primers for resequencing UBE2C
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat UBE2C
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat UBE2C
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat UBE2C
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat UBE2C
     GenScript Purified and Recombinant Proteins for UBE2C GenScript cDNA clones with any tag delivered in your preferred vector for UBE2C
     GenScript Custom Assay Services for UBE2C GenScript Custom Superior Antibodies Services for UBE2C
     GenScript Custom overexpressing Cell Line Services for UBE2C CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in UBE2C promoter
     Search Chromatin IP Primers for UBE2C
     RT2 qPCR Primer Assay in human, mouse, rat UBE2C
     GNC Network for UBE2C
     SABiosciences PCR Arrays including human, mouse, rat UBE2C
     Search Tocris compounds for UBE2C
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological Cell Lysates
     Browse Sino Biological cDNA Clones
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Proteins for UBE2C
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     UBE2C antibodies
     UBE2C proteins
     UBE2C lysates
     Antibodies for UBE2C
     See all of Abcam's Antibodies, Kits and Proteins for UBE2C
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for UBE2C




     Proteins for UBE2C
     Antibodies for UBE2C
     ELISAs for UBE2C
     CLIAs for UBE2C
     Search LifeMap BioReagents cell lines for UBE2C
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for UBE2C
     SwitchGear 3'UTR luciferase reporter plasmids for UBE2C
     SwitchGear Promoter luciferase reporter plasmids for UBE2C
     ThermoFisher Antibodies for UBE2C
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat UBE2C
     inGenious Targeting Laboratory - Custom generated mouse model solutions for UBE2C
     inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for UBE2C
    Customized:
     lentivirus for stable overexpression of UBE2C
     lentivirus expression plasmids for stable overexpression of UBE2C
     adenovirus for overexpression of UBE2C
     LSBio Antibodies in human, mouse, rat for UBE2C
    		Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
           
    GeneCards Homepage - Last full update: 23 Oct 2013 - Incrementals: 4 Nov 2013 , 7 Nov 2013 , 23 Jan 2014

    View Random Gene

    Category
    (GIFtS: 73)
    transforming growth factor, beta 1
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 

    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Copyright © 1996-2014 , Weizmann Institute of Science. All Rights Reserved.
    Hot genes      Disease genes      UBE2C gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 106 solr: 1.4