Free for academic non-profit institutions. Other users need a Commercial license

Aliases for TSSK2 Gene

Aliases for TSSK2 Gene

  • Testis Specific Serine Kinase 2 2 3 5
  • Serine/Threonine Kinase 22B (Spermiogenesis Associated) 2 3
  • Serine/Threonine-Protein Kinase 22B 3 4
  • DiGeorge Syndrome Protein G 3 4
  • Testis-Specific Kinase 2 3 4
  • EC 2.7.11.1 4 61
  • STK22B 3 4
  • SPOGA2 3 4
  • TSSK-2 3 4
  • DGS-G 3 4
  • TSK-2 3 4
  • TSK2 3 4
  • Testis-Specific Serine/Threonine-Protein Kinase 2 3
  • Testis Specific Serine Threonine Kinase 2 3
  • Testicular Secretory Protein Li 61 3
  • Spermiogenesis Associated 2 3
  • EC 2.7.11 61
  • DGSG 4

External Ids for TSSK2 Gene

Previous HGNC Symbols for TSSK2 Gene

  • STK22B

Previous GeneCards Identifiers for TSSK2 Gene

  • GC22P017495
  • GC22P017497
  • GC22P017500
  • GC22P017502
  • GC22P017504
  • GC22P017507
  • GC22P017509
  • GC22P019118
  • GC22P002739

Summaries for TSSK2 Gene

Entrez Gene Summary for TSSK2 Gene

  • TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM, Mar 2008]

GeneCards Summary for TSSK2 Gene

TSSK2 (Testis Specific Serine Kinase 2) is a Protein Coding gene. Among its related pathways are Transcription_CREM signaling in testis and Sweet Taste Signaling. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is TSSK1B.

UniProtKB/Swiss-Prot for TSSK2 Gene

  • Testis-specific serine/threonine-protein kinase required during spermatid development. Phosphorylates TSKS at Ser-288 and SPAG16. Involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. During spermatogenesis, required for the transformation of a ring-shaped structure around the base of the flagellum originating from the chromatoid body.

Gene Wiki entry for TSSK2 Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for TSSK2 Gene

Genomics for TSSK2 Gene

Regulatory Elements for TSSK2 Gene

Enhancers for TSSK2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH22F019169 1.2 ENCODE 12 +44.0 43992 11.0 HDGF PKNOX1 ARNT CREB3L1 MLX ARID4B SIN3A FEZF1 DMAP1 YY1 SLC25A1 CLTCL1 LINC01311 RPL7AP70 GSC2 DGCR14 TSSK2 TSSK1A DGCR2 ENSG00000223461
GH22F019097 1 Ensembl ENCODE 12.5 -32.2 -32211 2.4 HDGF YBX3 CTCF KLF1 RAD21 FOSL1 ZNF316 ZFHX2 SCRT2 SMC3 DGCR2 ENSG00000223461 TSSK1A TSSK2 RPL7AP70 DGCR11 PIR39211 GC22P019184
GH22F019463 0.7 ENCODE 10.4 +333.2 333214 1.8 SMARCE1 GTF2E2 NR4A1 JUN TSC22D4 NFXL1 POLR2H MBD2 ZNF121 GATA3 UFD1L E2F6P1 MRPL40 CLTCL1 ENSG00000273300 DGCR8 TSSK2 TSSK1A DGCR2 ENSG00000223461
GH22F019066 0.6 ENCODE 11.2 -64.0 -63957 1.0 POLR2H JUND POLR2A DDX20 ID3 NFXL1 DGCR2 ENSG00000223461 TSSK1A TSSK2 DGCR11 GC22M019062 GC22P019184
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around TSSK2 on UCSC Golden Path with GeneCards custom track

Genomic Location for TSSK2 Gene

Chromosome:
22
Start:
19,130,808 bp from pter
End:
19,132,623 bp from pter
Size:
1,816 bases
Orientation:
Plus strand

Genomic View for TSSK2 Gene

Genes around TSSK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
TSSK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for TSSK2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for TSSK2 Gene

Proteins for TSSK2 Gene

  • Protein details for TSSK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q96PF2-TSSK2_HUMAN
    Recommended name:
    Testis-specific serine/threonine-protein kinase 2
    Protein Accession:
    Q96PF2
    Secondary Accessions:
    • Q8IY55

    Protein attributes for TSSK2 Gene

    Size:
    358 amino acids
    Molecular mass:
    40939 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Interacts with TSSK1B.
    Miscellaneous:
    • TSSK1B might be used as a target for male contraception or and intra-vaginal spermicides.

neXtProt entry for TSSK2 Gene

Selected DME Specific Peptides for TSSK2 Gene

Q96PF2:
  • NLLLDKDFNIKLSDF
  • SIIKTYEIFETS
  • LRIQKEHRV
  • KYCHDLD
  • LSHSWLQ
  • WSLGVILY
  • DTKTGLR
  • IPYQPKVYDIWSLGVILYIMVCGSMPYDDS
  • LSKTFCGSAAYAAPEV
  • IVHRDLK

Post-translational modifications for TSSK2 Gene

Other Protein References for TSSK2 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for TSSK2 Gene

Gene Families for TSSK2 Gene

Protein Domains for TSSK2 Gene

Suggested Antigen Peptide Sequences for TSSK2 Gene

Graphical View of Domain Structure for InterPro Entry

Q96PF2

UniProtKB/Swiss-Prot:

TSSK2_HUMAN :
  • Contains 1 protein kinase domain.
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
Domain:
  • Contains 1 protein kinase domain.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
genes like me logo Genes that share domains with TSSK2: view

Function for TSSK2 Gene

Molecular function for TSSK2 Gene

UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=10 uM for ATP {ECO:0000269 PubMed:20729278};
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by phosphorylation on Thr-174, potentially by autophosphorylation.
UniProtKB/Swiss-Prot Function:
Testis-specific serine/threonine-protein kinase required during spermatid development. Phosphorylates TSKS at Ser-288 and SPAG16. Involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. During spermatogenesis, required for the transformation of a ring-shaped structure around the base of the flagellum originating from the chromatoid body.

Enzyme Numbers (IUBMB) for TSSK2 Gene

Gene Ontology (GO) - Molecular Function for TSSK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding ISS --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity ISS --
GO:0005515 protein binding IPI 15044604
GO:0005524 ATP binding ISS --
genes like me logo Genes that share ontologies with TSSK2: view
genes like me logo Genes that share phenotypes with TSSK2: view

Animal Model Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for TSSK2

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for TSSK2 Gene

Localization for TSSK2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for TSSK2 Gene

Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Note=Present in the cytoplasm of elongating spermatids. In spermatozoa, localizes in the equatorial segment, neck, the midpiece and in a specific sperm head compartment (By similarity). In spermatids, concentrates in centrioles during flagellogenesis. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for TSSK2 gene
Compartment Confidence
nucleus 5
cytoskeleton 3
cytosol 3
extracellular 1
peroxisome 1

Gene Ontology (GO) - Cellular Components for TSSK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001669 acrosomal vesicle IEA --
GO:0005634 nucleus IDA 21630459
GO:0005737 cytoplasm ISS,IBA --
GO:0005814 centriole IEA --
GO:0005856 cytoskeleton IEA --
genes like me logo Genes that share ontologies with TSSK2: view

Pathways & Interactions for TSSK2 Gene

genes like me logo Genes that share pathways with TSSK2: view

Pathways by source for TSSK2 Gene

1 GeneGo (Thomson Reuters) pathway for TSSK2 Gene
1 Qiagen pathway for TSSK2 Gene

Gene Ontology (GO) - Biological Process for TSSK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation ISS --
GO:0007275 multicellular organism development IEA --
GO:0007283 spermatogenesis IEA --
GO:0007286 spermatid development ISS --
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with TSSK2: view

No data available for SIGNOR curated interactions for TSSK2 Gene

Drugs & Compounds for TSSK2 Gene

(2) Drugs for TSSK2 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
Magnesium Nutra 0

(1) Additional Compounds for TSSK2 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with TSSK2: view

Transcripts for TSSK2 Gene

mRNA/cDNA for TSSK2 Gene

(1) REFSEQ mRNAs :
(4) Additional mRNA sequences :
(1) Selected AceView cDNA sequences:
(1) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Unigene Clusters for TSSK2 Gene

Testis-specific serine kinase 2:
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for TSSK2

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for TSSK2 Gene

No ASD Table

Relevant External Links for TSSK2 Gene

GeneLoc Exon Structure for
TSSK2
ECgene alternative splicing isoforms for
TSSK2

Expression for TSSK2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for TSSK2 Gene

Protein differential expression in normal tissues from HIPED for TSSK2 Gene

This gene is overexpressed in Testis (69.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for TSSK2 Gene



Protein tissue co-expression partners for TSSK2 Gene

NURSA nuclear receptor signaling pathways regulating expression of TSSK2 Gene:

TSSK2

SOURCE GeneReport for Unigene cluster for TSSK2 Gene:

Hs.694070

mRNA Expression by UniProt/SwissProt for TSSK2 Gene:

Q96PF2-TSSK2_HUMAN
Tissue specificity: Testis-specific. Present in mature spermatozoa (at protein level).
genes like me logo Genes that share expression patterns with TSSK2: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for TSSK2 Gene

Orthologs for TSSK2 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for TSSK2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia TSSK2 34 35
  • 99.53 (n)
mouse
(Mus musculus)
Mammalia Tssk2 34 16 35
  • 89.48 (n)
rat
(Rattus norvegicus)
Mammalia Tssk2 34
  • 89.48 (n)
cow
(Bos Taurus)
Mammalia TSSK2 34 35
  • 89.2 (n)
oppossum
(Monodelphis domestica)
Mammalia TSSK2 35
  • 89 (a)
OneToOne
dog
(Canis familiaris)
Mammalia TSSK2 34 35
  • 86.69 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia TSSK2 35
  • 80 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 72 (a)
OneToMany
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.4797 34
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008765 34
  • 53.21 (n)
worm
(Caenorhabditis elegans)
Secernentea tag-344 35
  • 30 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes KIN4 35
  • 14 (a)
ManyToMany
FRK1 35
  • 13 (a)
ManyToMany
-- 35
  • 11 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.4544 35
  • 50 (a)
OneToMany
Species where no ortholog for TSSK2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)
  • zebrafish (Danio rerio)

Evolution for TSSK2 Gene

ENSEMBL:
Gene Tree for TSSK2 (if available)
TreeFam:
Gene Tree for TSSK2 (if available)

Paralogs for TSSK2 Gene

Paralogs for TSSK2 Gene

(24) SIMAP similar genes for TSSK2 Gene using alignment to 2 proteins:

genes like me logo Genes that share paralogs with TSSK2: view

Variants for TSSK2 Gene

Sequence variations from dbSNP and Humsavar for TSSK2 Gene

SNP ID Clin Chr 22 pos Sequence Context AA Info Type
rs1052756 -- 19,132,173(+) GTCAG(C/T)CAGCG nc-transcript-variant, reference, synonymous-codon, utr-variant-3-prime
rs1052763 -- 19,132,238(+) AGCCA(C/T)GTCTT nc-transcript-variant, reference, missense, utr-variant-3-prime
rs1052773 -- 19,132,425(+) TCCAG(A/G)GCCAA nc-transcript-variant, reference, synonymous-codon, utr-variant-3-prime
rs1056788 -- 19,130,543(-) AAATA(A/G)TCACT nc-transcript-variant, upstream-variant-2KB, utr-variant-3-prime
rs114855227 -- 19,130,169(+) GCACC(A/G)CTGCC downstream-variant-500B, upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for TSSK2 Gene

Variant ID Type Subtype PubMed ID
nsv953022 CNV deletion 24416366
nsv834122 CNV loss 17160897
nsv588216 CNV gain 21841781
nsv588213 CNV gain 21841781
nsv1056141 CNV gain 25217958
esv3575418 CNV gain 25503493

Variation tolerance for TSSK2 Gene

Residual Variation Intolerance Score: 71.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 8.32; 85.28% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for TSSK2 Gene

Human Gene Mutation Database (HGMD)
TSSK2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
TSSK2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TSSK2 Gene

Disorders for TSSK2 Gene

Relevant External Links for TSSK2

Genetic Association Database (GAD)
TSSK2
Human Genome Epidemiology (HuGE) Navigator
TSSK2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
TSSK2

No disorders were found for TSSK2 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for TSSK2 Gene

Publications for TSSK2 Gene

  1. Some single-nucleotide polymorphisms of the TSSK2 gene may be associated with human spermatogenesis impairment. (PMID: 19926886) Zhang H. … Zhang S. (J. Androl. 2010) 3 4 46 64
  2. The DNA sequence of human chromosome 22. (PMID: 10591208) Dunham I. … Wright H. (Nature 1999) 2 3 4 64
  3. Expression and localization of five members of the testis-specific serine kinase (Tssk) family in mouse and human sperm and testis. (PMID: 20729278) Li Y. … Salicioni A.M. (Mol. Hum. Reprod. 2011) 3 4 64
  4. Targeted deletion of Tssk1 and 2 causes male infertility due to haploinsufficiency. (PMID: 18533145) Xu B. … Herr J.C. (Dev. Biol. 2008) 3 4 64
  5. Validation of a testis specific serine/threonine kinase [TSSK] family and the substrate of TSSK1 & 2, TSKS, as contraceptive targets. (PMID: 17566264) Xu B. … Herr J.C. (Soc. Reprod. Fertil. Suppl. 2007) 4 22 64

Products for TSSK2 Gene

Sources for TSSK2 Gene

Content
Loading form....