Free for academic non-profit institutions. Other users need a Commercial license

Aliases for TRPM7 Gene

Aliases for TRPM7 Gene

  • Transient Receptor Potential Cation Channel Subfamily M Member 7 2 3 5
  • Long Transient Receptor Potential Channel 7 3 4
  • Channel-Kinase 1 3 4
  • EC 2.7.11.1 4 61
  • LTrpC-7 3 4
  • LTRPC7 3 4
  • CHAK1 3 4
  • Transient Receptor Potential Cation Channel, Subfamily M, Member 7 2
  • Transient Receptor Potential-Phospholipase C-Interacting Kinase 3
  • LTRPC Ion Channel Family Member 7 3
  • TRP-PLIK 3
  • ALSPDC 3
  • CHAK 3

External Ids for TRPM7 Gene

Previous GeneCards Identifiers for TRPM7 Gene

  • GC15M046409
  • GC15M043898
  • GC15M048431
  • GC15M048568
  • GC15M048639
  • GC15M050852
  • GC15M027680

Summaries for TRPM7 Gene

Entrez Gene Summary for TRPM7 Gene

  • The protein encoded by this gene is both an ion channel and a serine/threonine protein kinase. The kinase activity is essential for the ion channel function, which serves to increase intracellular calcium levels and to help regulate magnesium ion homeostasis. Defects in this gene are a cause of amyotrophic lateral sclerosis-parkinsonism/dementia complex of Guam. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2014]

GeneCards Summary for TRPM7 Gene

TRPM7 (Transient Receptor Potential Cation Channel Subfamily M Member 7) is a Protein Coding gene. Diseases associated with TRPM7 include Amyotrophic Lateral Sclerosis-Parkinsonism/Dementia Complex and Ophthalmomyiasis. Among its related pathways are Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds and Ion channel transport. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and actin binding. An important paralog of this gene is TRPM6.

UniProtKB/Swiss-Prot for TRPM7 Gene

  • Essential ion channel and serine/threonine-protein kinase. Divalent cation channel permeable to calcium and magnesium. Has a central role in magnesium ion homeostasis and in the regulation of anoxic neuronal cell death. Involved in TNF-induced necroptosis downstream of MLKL by mediating calcium influx. The kinase activity is essential for the channel function. May be involved in a fundamental process that adjusts plasma membrane divalent cation fluxes according to the metabolic state of the cell. Phosphorylates annexin A1 (ANXA1).

Gene Wiki entry for TRPM7 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for TRPM7 Gene

Genomics for TRPM7 Gene

Regulatory Elements for TRPM7 Gene

Enhancers for TRPM7 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH15G050878 1.8 FANTOM5 Ensembl ENCODE dbSUPER 12.9 -193.5 -193478 3.4 HDAC1 TBP PKNOX1 ZNF766 ETV6 IKZF2 CREM CBFB CEBPB JUNB AP4E1 TRPM7 RN7SL354P ENSG00000259306 SPPL2A USP8 GC15P050883 PIR42507
GH15G050876 1.7 FANTOM5 Ensembl ENCODE dbSUPER 13 -190.2 -190197 1.2 ARID4B SIN3A BRCA1 YY1 ELK1 ZNF143 ZHX2 REST MAFF SMARCA4 TRPM7 AP4E1 RN7SL354P SPPL2A USP8 GC15P050883 PIR42507
GH15G051620 1.8 FANTOM5 ENCODE dbSUPER 10.9 -935.6 -935637 4.4 PKNOX1 FOXA2 ARNT SIN3A ARID4B DMAP1 ZBTB7B ZNF766 ZNF416 FOS DMXL2 SCG3 LYSMD2 TRPM7 ENSG00000260618 MAPK6 TMOD2 TMOD3 ENSG00000259678 GC15M056538
GH15G050718 1 ENCODE 18.7 -32.2 -32169 1.6 PKNOX1 FOXA2 MLX ARID4B DMAP1 ZNF48 YY1 SLC30A9 GATA2 MXD4 TRPM7 SPPL2A RN7SL354P RPL32P30 GC15P050730
GH15G050711 0.9 ENCODE 18.9 -25.3 -25265 1.1 HDGF ATF1 PKNOX1 ARNT TCF12 GATA2 NCOA1 SMARCA4 MYNN PBX2 TRPM7 RN7SL354P AP4E1 GC15P050730
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around TRPM7 on UCSC Golden Path with GeneCards custom track

Promoters for TRPM7 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000076496 315 2201 HDGF PKNOX1 MLX CREB3L1 ARNT ARID4B SIN3A DMAP1 ZNF2 ZBTB7B

Genomic Location for TRPM7 Gene

Chromosome:
15
Start:
50,552,473 bp from pter
End:
50,686,815 bp from pter
Size:
134,343 bases
Orientation:
Minus strand

Genomic View for TRPM7 Gene

Genes around TRPM7 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
TRPM7 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for TRPM7 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for TRPM7 Gene

Proteins for TRPM7 Gene

  • Protein details for TRPM7 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q96QT4-TRPM7_HUMAN
    Recommended name:
    Transient receptor potential cation channel subfamily M member 7
    Protein Accession:
    Q96QT4
    Secondary Accessions:
    • Q6ZMF5
    • Q86VJ4
    • Q8NBW2
    • Q9BXB2
    • Q9NXQ2

    Protein attributes for TRPM7 Gene

    Size:
    1865 amino acids
    Molecular mass:
    212697 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Homodimer. Interacts with PLCB1 (By similarity). Forms heterodimers with TRPM6.
    SequenceCaution:
    • Sequence=BAC11462.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAD18773.1; Type=Erroneous initiation; Evidence={ECO:0000305};

neXtProt entry for TRPM7 Gene

Selected DME Specific Peptides for TRPM7 Gene

Q96QT4:
  • NWSNSTCLKLAVS
  • EGGPNVIL
  • AGRLIYC
  • LEQAMLDALVMDRV
  • MELPKLVISVHGG
  • FLTIPRLEELYNTKQGPTN
  • PRFLEVFL
  • KKLHDFEEQCVE
  • TVLHLCLREIQQQRAAQKL
  • VDDTSEELK
  • WSVEKHT
  • TVYRLEESSP
  • MVFGPANLGEDAI
  • LTPFLQAVYLFVQYIIMVNLLIA
  • PVVVCEGTGRAADLLA
  • SMSSWSQ
  • ERNNLMRLSQ
  • KHVGDALK
  • PWGVIEN
  • MLAFSHWTYEYTRGELLVLDLQGVGENLTDPSVIK
  • MTGEFRKYNNNNGDEI
  • LPDLKRNDY
  • ITLIDIGLV
  • IPSSKDPHRC
  • GHLQDLSALTVDTLK

Post-translational modifications for TRPM7 Gene

Domains & Families for TRPM7 Gene

Gene Families for TRPM7 Gene

Protein Domains for TRPM7 Gene

Suggested Antigen Peptide Sequences for TRPM7 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q96QT4

UniProtKB/Swiss-Prot:

TRPM7_HUMAN :
  • In the C-terminal section; belongs to the protein kinase superfamily. Alpha-type protein kinase family. ALPK subfamily.
Family:
  • In the C-terminal section; belongs to the protein kinase superfamily. Alpha-type protein kinase family. ALPK subfamily.
  • In the N-terminal section; belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM7 sub-subfamily.
genes like me logo Genes that share domains with TRPM7: view

Function for TRPM7 Gene

Molecular function for TRPM7 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Essential ion channel and serine/threonine-protein kinase. Divalent cation channel permeable to calcium and magnesium. Has a central role in magnesium ion homeostasis and in the regulation of anoxic neuronal cell death. Involved in TNF-induced necroptosis downstream of MLKL by mediating calcium influx. The kinase activity is essential for the channel function. May be involved in a fundamental process that adjusts plasma membrane divalent cation fluxes according to the metabolic state of the cell. Phosphorylates annexin A1 (ANXA1).

Enzyme Numbers (IUBMB) for TRPM7 Gene

Gene Ontology (GO) - Molecular Function for TRPM7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003779 actin binding IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005216 ion channel activity IEA --
GO:0005262 calcium channel activity TAS --
GO:0005524 ATP binding IEA --
genes like me logo Genes that share ontologies with TRPM7: view
genes like me logo Genes that share phenotypes with TRPM7: view

Animal Models for TRPM7 Gene

MGI Knock Outs for TRPM7:

Animal Model Products

CRISPR Products

miRNA for TRPM7 Gene

miRTarBase miRNAs that target TRPM7

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for TRPM7

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for TRPM7 Gene

Localization for TRPM7 Gene

Subcellular locations from UniProtKB/Swiss-Prot for TRPM7 Gene

Membrane; Multi-pass membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for TRPM7 gene
Compartment Confidence
plasma membrane 5
extracellular 2
cytoskeleton 2
nucleus 2
cytosol 2
endoplasmic reticulum 1

Gene Ontology (GO) - Cellular Components for TRPM7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001726 ruffle IEA --
GO:0005623 cell IEA --
GO:0005886 plasma membrane TAS --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
genes like me logo Genes that share ontologies with TRPM7: view

Pathways & Interactions for TRPM7 Gene

genes like me logo Genes that share pathways with TRPM7: view

Pathways by source for TRPM7 Gene

SIGNOR curated interactions for TRPM7 Gene

Activates:

Gene Ontology (GO) - Biological Process for TRPM7 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0006810 transport IEA --
GO:0006811 ion transport IEA --
GO:0006812 cation transport IEA --
GO:0006816 calcium ion transport IEA --
genes like me logo Genes that share ontologies with TRPM7: view

Drugs & Compounds for TRPM7 Gene

(15) Drugs for TRPM7 Gene - From: DrugBank, DGIdb, IUPHAR, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Nafamostat Approved, Investigational Pharma Channel blocker 4
spermine Approved Nutra Full agonist, Agonist 0
Adenosine triphosphate Approved Nutra 0
1,4-Dithiothreitol Experimental Pharma Target 0
Phosphoaminophosphonic Acid-Adenylate Ester Experimental Pharma Target 0

(3) Additional Compounds for TRPM7 Gene - From: IUPHAR and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
carvacrol
Channel blocker
H<sup>+</sup> (extracellular)
Activator
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with TRPM7: view

Transcripts for TRPM7 Gene

Unigene Clusters for TRPM7 Gene

Transient receptor potential cation channel, subfamily M, member 7:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for TRPM7

Alternative Splicing Database (ASD) splice patterns (SP) for TRPM7 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b ^ 17 ^ 18a · 18b ^ 19 ^ 20 ^ 21 ^ 22 ^ 23 ^ 24 ^
SP1:
SP2:
SP3:
SP4: -
SP5:
SP6:

ExUns: 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31a · 31b ^ 32 ^ 33 ^ 34 ^ 35 ^ 36a · 36b
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:

Relevant External Links for TRPM7 Gene

GeneLoc Exon Structure for
TRPM7
ECgene alternative splicing isoforms for
TRPM7

Expression for TRPM7 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for TRPM7 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for TRPM7 Gene

This gene is overexpressed in Serum (65.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for TRPM7 Gene



Protein tissue co-expression partners for TRPM7 Gene

NURSA nuclear receptor signaling pathways regulating expression of TRPM7 Gene:

TRPM7

SOURCE GeneReport for Unigene cluster for TRPM7 Gene:

Hs.512894

Evidence on tissue expression from TISSUES for TRPM7 Gene

  • Intestine(4.5)
  • Liver(4.4)
  • Nervous system(2.9)
  • Kidney(2.7)
  • Heart(2.5)
  • Muscle(2.4)

Phenotype-based relationships between genes and organs from Gene ORGANizer for TRPM7 Gene

Germ Layers:
  • ectoderm
  • mesoderm
Systems:
  • nervous
  • skeletal muscle
Organs:
Head and neck:
  • brain
  • cerebellum
  • cranial nerve
  • face
  • head
  • jaw
  • mandible
  • maxilla
  • mouth
  • nose
  • skull
  • tongue
Limb:
  • lower limb
  • upper limb
General:
  • peripheral nerve
  • peripheral nervous system
  • spinal cord
genes like me logo Genes that share expression patterns with TRPM7: view

Primer Products

No data available for mRNA differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for TRPM7 Gene

Orthologs for TRPM7 Gene

This gene was present in the common ancestor of animals.

Orthologs for TRPM7 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia TRPM7 34 35
  • 99.7 (n)
cow
(Bos Taurus)
Mammalia TRPM7 34 35
  • 94.62 (n)
dog
(Canis familiaris)
Mammalia TRPM7 34 35
  • 94.51 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 91 (a)
OneToMany
-- 35
  • 89 (a)
OneToMany
-- 35
  • 84 (a)
OneToMany
mouse
(Mus musculus)
Mammalia Trpm7 34 16 35
  • 90.83 (n)
rat
(Rattus norvegicus)
Mammalia Trpm7 34
  • 90.6 (n)
oppossum
(Monodelphis domestica)
Mammalia TRPM7 35
  • 89 (a)
OneToOne
chicken
(Gallus gallus)
Aves gga-mir-6596 35
  • 86 (a)
OneToOne
TRPM7 34
  • 82.3 (n)
lizard
(Anolis carolinensis)
Reptilia TRPM7 35
  • 85 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia trpm7 34
  • 75.15 (n)
zebrafish
(Danio rerio)
Actinopterygii trpm7 34 35
  • 66.12 (n)
-- 34
fruit fly
(Drosophila melanogaster)
Insecta CG30078 36
  • 43 (a)
CG30079 36
  • 43 (a)
Species where no ortholog for TRPM7 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for TRPM7 Gene

ENSEMBL:
Gene Tree for TRPM7 (if available)
TreeFam:
Gene Tree for TRPM7 (if available)

Paralogs for TRPM7 Gene

Paralogs for TRPM7 Gene

(4) SIMAP similar genes for TRPM7 Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with TRPM7: view

Variants for TRPM7 Gene

Sequence variations from dbSNP and Humsavar for TRPM7 Gene

SNP ID Clin Chr 15 pos Sequence Context AA Info Type
VAR_042396 An ovarian serous carcinoma sample
VAR_042399 A breast infiltrating ductal carcinoma sample
VAR_042400 A gastric adenocarcinoma sample
rs8042919 other 50,586,433(+) AGTCA(A/G)TAAAT nc-transcript-variant, reference, missense
rs1000038635 -- 50,616,468(+) AAAGA(C/T)CAAAT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for TRPM7 Gene

Variant ID Type Subtype PubMed ID
dgv2594n100 CNV gain 25217958
dgv317n27 CNV gain 19166990
dgv4525n54 CNV gain 21841781
dgv4526n54 CNV gain 21841781
esv1392000 CNV insertion 17803354
esv2664477 CNV deletion 23128226
esv2674857 CNV deletion 23128226
esv2749686 CNV deletion 23290073
esv2749687 CNV deletion 23290073
esv3444919 CNV insertion 20981092
esv3552436 CNV deletion 23714750
esv3552437 CNV deletion 23714750
esv3636446 CNV gain 21293372
esv3636447 CNV loss 21293372
esv3636448 CNV loss 21293372
nsv1047443 CNV gain 25217958
nsv1048114 CNV gain 25217958
nsv1050385 CNV gain 25217958
nsv1051400 CNV gain 25217958
nsv1055119 CNV gain 25217958
nsv1127432 CNV deletion 24896259
nsv1147970 CNV deletion 26484159
nsv1532 CNV insertion 18451855
nsv471242 CNV gain 18288195
nsv524596 CNV loss 19592680
nsv524613 CNV loss 19592680
nsv569398 CNV loss 21841781
nsv569401 CNV loss 21841781

Variation tolerance for TRPM7 Gene

Residual Variation Intolerance Score: 1.14% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.62; 72.56% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for TRPM7 Gene

Human Gene Mutation Database (HGMD)
TRPM7
SNPedia medical, phenotypic, and genealogical associations of SNPs for
TRPM7

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TRPM7 Gene

Disorders for TRPM7 Gene

MalaCards: The human disease database

(5) MalaCards diseases for TRPM7 Gene - From: OMIM, Orphanet, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
amyotrophic lateral sclerosis-parkinsonism/dementia complex
  • amyotrophic lateral sclerosis-parkinsonism/dementia complex 1
ophthalmomyiasis
  • ocular myiasis
myiasis
  • infestation by fly larvae
dementia
  • presenile dementia
amyotrophic lateral sclerosis 1
  • amyotrophic lateral sclerosis
- elite association - COSMIC cancer census association via MalaCards
Search TRPM7 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

TRPM7_HUMAN
  • Amyotrophic lateral sclerosis-parkinsonism/dementia complex 1 (ALS-PDC1) [MIM:105500]: A neurodegenerative disorder characterized by chronic, progressive and uniformly fatal amyotrophic lateral sclerosis and parkinsonism-dementia. Both diseases are known to occur in the same kindred, the same sibship and even the same individual. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.

Relevant External Links for TRPM7

Genetic Association Database (GAD)
TRPM7
Human Genome Epidemiology (HuGE) Navigator
TRPM7
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
TRPM7
genes like me logo Genes that share disorders with TRPM7: view

No data available for Genatlas for TRPM7 Gene

Publications for TRPM7 Gene

  1. LTRPC7 is a Mg.ATP-regulated divalent cation channel required for cell viability. (PMID: 11385574) Nadler M.J.S. … Fleig A. (Nature 2001) 2 3 4 22 64
  2. TRPM7 is not associated with amyotrophic lateral sclerosis-parkinsonism dementia complex in the Kii peninsula of Japan. (PMID: 19405049) Hara K. … Tsuji S. (Am. J. Med. Genet. B Neuropsychiatr. Genet. 2010) 3 22 46 64
  3. A TRPM7 variant shows altered sensitivity to magnesium that may contribute to the pathogenesis of two Guamanian neurodegenerative disorders. (PMID: 16051700) Hermosura M.C. … Garruto R.M. (Proc. Natl. Acad. Sci. U.S.A. 2005) 3 4 22 64
  4. Regulation of vertebrate cellular Mg2+ homeostasis by TRPM7. (PMID: 12887921) Schmitz C. … Scharenberg A.M. (Cell 2003) 3 4 22 64
  5. Plasma membrane translocation of trimerized MLKL protein is required for TNF-induced necroptosis. (PMID: 24316671) Cai Z. … Liu Z.G. (Nat. Cell Biol. 2014) 3 4 64

Products for TRPM7 Gene

Sources for TRPM7 Gene

Content
Loading form....