Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

TRIO Gene

protein-coding   GIFtS: 64
GCID: GC05P014143

trio Rho guanine nucleotide exchange factor

(Previous name: triple functional domain (PTPRF interacting) )
 Explore 15 diseases affiliated with
TRIO via our new
 Human Malady Compendium 
Biological research products
for TRIO
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Trio Rho Guanine Nucleotide Exchange Factor1 2     EC 2.7.11.13 8
ARHGEF231 2     Tgat1
Triple Functional Domain (PTPRF Interacting)1 2     Triple Functional Domain Protein2
PTPRF-Interacting Protein2 3     

External Ids:    HGNC: 123031   Entrez Gene: 72042   Ensembl: ENSG000000383827   OMIM: 6018935   UniProtKB: O759623   

Export aliases for TRIO gene to outside databases

Previous GC identifers: GC05U990059 GC05P014425 GC05P014176 GC05P014196


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

UniProtKB/Swiss-Prot: TRIO_HUMAN, O75962
Function: Promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could play a
role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell growth

Gene Wiki entry for TRIO


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000005.9  NC_018916.1  NT_006576.16  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the TRIO gene promoter:
         Elk-1   Pbx1a   GATA-3   Egr-1   C/EBPalpha   GATA-1   GATA-2   Egr-4   AREB6   ATF6   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): TRIO promoter sequence
   Search SABiosciences Chromatin IP Primers for TRIO

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat TRIO


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 5p15.2   Ensembl cytogenetic band:  5p15.2   HGNC cytogenetic band: 5p14-p15.1

TRIO Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
TRIO gene location

GeneLoc information about chromosome 5         GeneLoc Exon Structure

GeneLoc location for GC05P014143:  view genomic region     (about GC identifiers)

Start:
14,143,811 bp from pter      End:
14,532,235 bp from pter
Size:
388,425 bases      Orientation:
plus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: TRIO_HUMAN, O75962 (See protein sequence)
Recommended Name: Triple functional domain protein  
Size: 3097 amino acids; 346900 Da
Subunit: Interacts to form a complex with leukocyte antigen related protein
Subcellular location: Cytoplasm (By similarity)
Sequence caution: Sequence=AAC34245.1; Type=Erroneous initiation; Note=Translation N-terminally extended;
Sequence=AAC34245.1; Type=Frameshift; Positions=2301; Sequence=AAC43042.1; Type=Erroneous initiation;
2 PDB 3D structures from and Proteopedia for TRIO:
1NTY (3D)        2NZ8 (3D)    
Secondary accessions: D3DTD1 Q13458 Q59EQ7 Q6PJC9 Q6ZN05 Q8IWK8
Alternative splicing: 5 isoforms:  O75962-1   O75962-2   O75962-3   O75962-4   O75962-5   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for TRIO: NX_O75962

Post-translational modifications:

  • Phosphorylated on serine residue(s)1
  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_O75962

  • 18 DME Specific Peptides for TRIO (O75962) (see first 4)
     DPCKFAL  SPIEYQR  KYQLLLK  ELNEEKR 
     RRKHQND  ANYSKAVH  FLQLRIFE  QRENRVLH 
     GHYASQQI  LSGVSPFLD  VCKRGFTVI  LLDMSVSFHTH 
     KTHQSALQVQQKAE  IHVALIIKPDNFWQKQ  IWQHRKVRLHQRLQLCVFQQ  LDQCFQLRLFEQDAEKMFDWI 
     KRRLDQCQQYVVFERSAKQAL  NIFLKELEKYEQLPEDVGHCFVTWADKFQMYV 

    TRIO Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins: NP_009049.2  
    ENSEMBL proteins: 
     ENSP00000339299   ENSP00000421555   ENSP00000445592   ENSP00000426342   ENSP00000339291  
     ENSP00000446348  
    Reactome Protein details: O75962
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    Browse OriGene Protein Over-expression Lysates
    OriGene Custom Protein Services for TRIO 
    GenScript Custom Purified and Recombinant Proteins Services for TRIO
    Novus Biologicals TRIO Protein
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for TRIO

    Gene Ontology (GO): 2 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005622intracellular ----
    GO:0005829cytosol TAS--


    TRIO for ontologies           About GeneDecksing



    TRIO Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for TRIO 
    GenScript Superior Antibodies for TRIO
    Novus Biologicals TRIO Antibodies
    Search for Antibodies for TRIO at Abcam  
    Uscn Antibodies for TRIO
    Search ThermoFisher Antibodies for TRIO

    Assay Products for TRIO: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for TRIO
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for TRIO


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    TRIO for domains           About GeneDecksing

    5/15 InterPro domains/families (see all 15):
     IPR003598 Ig_sub2
     IPR007110 Ig-like_dom
     IPR002017 Spectrin_repeat
     IPR002290 Ser/Thr_dual-sp_kinase_dom
     IPR000219 DH-domain

    Graphical View of Domain Structure for InterPro Entry O75962

    ProtoNet protein and cluster: O75962

    5/7 Blocks protein families (see all 7):
    IPB000219 DH domain
    IPB001251 Cellular retinaldehyde-binding (CRAL)/Triple function domain (TRIO)
    IPB001849 Pleckstrin-like
    IPB002017 Spectrin repeat
    IPB003598 Immunoglobulin C-2 type


    UniProtKB/Swiss-Prot: TRIO_HUMAN, O75962
    Domain: The N-terminal DBL/GEF domain specifically catalyzes nucleotide exchange for RAC1, leading to the activation of
    Jun kinase and the production of membrane ruffles. The second DBL/GEF domain is an exchange factor for rhoa and
    induces the formation of stress fibers
    Similarity: Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family
    Similarity: Contains 1 CRAL-TRIO domain
    Similarity: Contains 2 DH (DBL-homology) domains
    Similarity: Contains 1 Ig-like C2-type (immunoglobulin-like) domain
    Similarity: Contains 2 PH domains
    Similarity: Contains 1 protein kinase domain
    Similarity: Contains 2 SH3 domains
    Similarity: Contains 4 spectrin repeats


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: TRIO_HUMAN, O75962
    Function: Promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could play a
    role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell growth
    Catalytic activity: ATP + a protein = ADP + a phosphoprotein

         Genatlas biochemistry entry for TRIO:
    trio phosphoprotein,with three enzymze domains,binding the LAR transmembrane tyrosine phosphatase (PTPRF),likely
    involved in active cell migration

    Enzyme Number (IUBMB): EC 2.7.11.11 2

    miRNA
    Products:
        
    OriGene 3'-UTR Clone: TRIO
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat TRIO
    8/28 QIAGEN miScript miRNA Assays for microRNAs that regulate TRIO (see all 28):
    hsa-miR-21* hsa-miR-448 hsa-miR-3673 hsa-miR-4311 hsa-miR-300 hsa-miR-429 hsa-miR-125a-3p hsa-miR-25
    SwitchGear 3'UTR luciferase reporter plasmidTRIO 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for TRIO (see all 6)
    OriGene siRNA: TRIO
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIO

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for TRIO

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for TRIO (see all 2)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for TRIO
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: TRIO (NM_007118)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIO
    Search Vector BioLabs for ready-to-use adenovirus/AAV for human, mouse, rat TRIO 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for TRIO
    Search LifeMap BioReagents cell lines for TRIO

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIO

    Gene Ontology (GO): 5/6 molecular function terms (GO ID links to tree view) (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004674protein serine/threonine kinase activity IEA--
    GO:0005085guanyl-nucleotide exchange factor activity TAS8643598
    GO:0005089Rho guanyl-nucleotide exchange factor activity IEA--
    GO:0005515protein binding IPI17043677
    GO:0005524ATP binding IEA--


    TRIO for ontologies           About GeneDecksing


    1 GenomeRNAi human phenotype for TRIO:
     Increased colony dispersion (i 

    Animal Models:
         Mouse knock-out Triotm1Mst for TRIO
         6 MGI mutant phenotypes (inferred from 2 alleles(MGI details for Trio):
     behavior/neurological  cellular  growth/size  mortality/aging  muscle 
     nervous system 

    TRIO for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/10 super-pathways (see all 10About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Cell death signalling via NRAGE, NRIF and NADE
    Cell death signalling via NRAGE, NRIF and NADE1.00
    G alpha (12/13) signalling events0.39
    NRAGE signals death through JNK0.74
    Rho GTPase cycle0.25
    p75 NTR receptor-mediated signalling0.73
    Signaling by Rho GTPases0.25
    2Signaling by GPCR
    Signaling by GPCR1.00
    Signal Transduction0.56
    GPCR downstream signaling0.89
    3G alpha (q) signalling events
    G alpha (q) signalling events1.00
    Gastrin-CREB signalling pathway via PKC and MAPK0.90
    4Axon guidance
    Axon guidance1.00
    Developmental Biology0.69
    5TRKA Signaling
    TRKA Signaling1.00
    NGF Pathway0.75

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    1 EMD Millipore Pathway for TRIO
        Cytoskeleton remodeling Integrin outside-in signaling

    2 Downloadable PowerPoint Slides of QIAGEN Pathway Central Maps for TRIO
        NGF Pathway
    TRKA Signaling

    1 GeneGo (Thomson Reuters) Pathway for TRIO
        Cytoskeleton remodeling Integrin outside-in signaling

    2 BioSystems Pathways for TRIO 
        Regulation of RAC1 activity
    Regulation of RhoA activity

    5/16        Reactome Pathways for TRIO (see all 16)
        Signaling by Rho GTPases
    GPCR downstream signaling
    Developmental Biology
    G alpha (12/13) signalling events
    Gastrin-CREB signalling pathway via PKC and MAPK



    TRIO for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for TRIO

    STRING Interaction Network Preview (showing 5 interactants - click image to see 16)

    5/21 Interacting proteins for TRIO (O759621, 2, 3 ENSP000003392994) via UniProtKB, MINT, STRING, and/or I2D (see all 21)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    BLMHQ138672, 3, ENSP000002617144MINT-64162 I2D: score=5 STRING: ENSP00000261714
    DISC1Q9NRI51, 3, ENSP000003555964EBI-718519,EBI-529989 I2D: score=2 STRING: ENSP00000355596
    RHOAP615863, ENSP000004001754I2D: score=3 STRING: ENSP00000400175
    PHLDA3Q9Y5J53, ENSP000003562784I2D: score=1 STRING: ENSP00000356278
    RAC1P630003, ENSP000003484614I2D: score=3 STRING: ENSP00000348461
    About this table

    Gene Ontology (GO): 5/7 biological process terms (GO ID links to tree view) (see all 7):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006915apoptotic process TAS--
    GO:0007185transmembrane receptor protein tyrosine phosphatase signaling pathway TAS8643598
    GO:0007264small GTPase mediated signal transduction TAS--
    GO:0007411axon guidance TAS--
    GO:0035023regulation of Rho protein signal transduction IEA--


    TRIO for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    TRIO for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Compounds for TRIO available from Tocris Bioscience    About this table
    CompoundAction CAS #
    ITX 3Selective inhibitor of TrioN RhoGEF activity[347323-96-0]

    1 HMDB Compound for TRIO    About this table
    CompoundSynonyms CAS #PubMed Ids
    Guanosine triphosphate5'-GTP (see all 10)86-01-1--
    2 Novoseek chemical compound relationships for TRIO gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    gdp 67.9 2 18505730 (1), 12475976 (1)
    gtp 60.8 6 18505730 (1), 12475976 (1)

    Search CenterWatch for drugs/clinical trials and news about TRIO 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for TRIO gene: 
    NM_007118.2  

    Unigene Cluster for TRIO:

    Trio Rho guanine nucleotide exchange factor
    Hs.130031  [show with all ESTs]
    Unigene Representative Sequence: NM_007118
    18/24 Ensembl transcripts including schematic representations, and UCSC links where relevant (see all 24):
    ENST00000505971 ENST00000502816 ENST00000344204(uc003jff.3 uc003jfg.3)
    ENST00000512070 ENST00000509967(uc011cna.1) ENST00000504606 ENST00000513206
    ENST00000515144(uc003jfh.1) ENST00000510757 ENST00000502490 ENST00000509354
    ENST00000512303 ENST00000512979 ENST00000507714 ENST00000515710 ENST00000506611
    ENST00000511019 ENST00000510281

    miRNA
    Products:
         
    OriGene 3'-UTR Clone: TRIO
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat TRIO
    8/28 QIAGEN miScript miRNA Assays for microRNAs that regulate TRIO (see all 28):
    hsa-miR-21* hsa-miR-448 hsa-miR-3673 hsa-miR-4311 hsa-miR-300 hsa-miR-429 hsa-miR-125a-3p hsa-miR-25
    SwitchGear 3'UTR luciferase reporter plasmidTRIO 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for TRIO (see all 6)
    OriGene siRNA: TRIO
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIO
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for TRIO (see all 2)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for TRIO
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: TRIO (NM_007118)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIO
    Search Vector BioLabs for ready-to-use adenovirus/AAV for human, mouse, rat TRIO 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for TRIO
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat TRIO
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIO
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIO

    Additional cDNA sequence: 

    AB115332.1 AB209754.1 AF091395.1 AK131423.1 AK304786.1 AL161955.1 BC017268.2 BC035585.1 
    U42390.1 

    24/30 DOTS entries (see all 30):

    DT.317209  DT.99952185  DT.91928318  DT.100748128  DT.99952587  DT.97795856  DT.412418  DT.91955186 
    DT.120798656  DT.99961039  DT.120798475  DT.75101160  DT.101966737  DT.86835808  DT.120798724  DT.100748127 
    DT.120798576  DT.91693359  DT.92442539  DT.120798653  DT.120798659  DT.92043783  DT.92442543  DT.97789826 

    24/383 AceView cDNA sequences (see all 383):

    AW589779 BQ774160 AW083155 AI632397 BM722637 BE857432 BQ917753 BM458619 
    AI042333 AI290702 AI885829 BF224017 AW014382 BQ003782 AA262902 AI521204 
    BF904204 AW502998 BE671819 BX644821 AW204990 AI922112 NM_007118 AW771524 

    GeneLoc Exon Structure

    5/17 Alternative Splicing Database (ASD) splice patterns (SP) for TRIO (see all 17)    About this scheme

    ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^ 22 ^ 23 ^
    SP1:              -                       -                                                                                                                     
    SP2:              -                       -                                                                                                                     
    SP3:                                                                                                                                                            
    SP4:                                      -                                                                                                                     
    SP5:                                                                                                                                                            

    ExUns: 24 ^ 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31 ^ 32 ^ 33 ^ 34a · 34b ^ 35 ^ 36a · 36b · 36c ^ 37 ^ 38a · 38b ^ 39a · 39b · 39c ^ 40a · 40b ^ 41 ^ 42 ^
    SP1:                                                              -           -                       -                                         -               
    SP2:                                                              -           -                       -                                         -               
    SP3:                                                              -           -                       -                                         -               
    SP4:                                                              -           -                                                                                 
    SP5:                                                                                                                                                            

    ExUns: 43 ^ 44 ^ 45a · 45b ^ 46 ^ 47 ^ 48a · 48b ^ 49a · 49b ^ 50 ^ 51a · 51b ^ 52a · 52b · 52c · 52d ^ 53a · 53b ^ 54a · 54b ^ 55 ^ 56a · 56b ^ 57a · 57b ^
    SP1:                                            -     -                       -     -     -     -     -     -                                               -   
    SP2:                                            -     -                             -     -     -     -     -                                               -   
    SP3:                                            -     -                                                                                                         
    SP4:                                                                                                                                                            
    SP5:                                                                                                  -     -                                               -   

    ExUns: 58 ^ 59a · 59b ^ 60 ^ 61a · 61b ·
    SP1:              -                     
    SP2:              -                     
    SP3:                                    
    SP4:                                    
    SP5:              -                     


    ECgene alternative splicing isoforms for TRIO

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TRIO expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: TTTACACAGT

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image

    TRIO expression in embryonic tissues and stem cells
    Expression by the Database of Embryonic development, Stem cell research, and Regenerative medicine    About this table
    10/20 LifeMap In Vivo Development Anatomical Compartments/Cells (see all 20
    Tissue Anatomical Compartment CellCategory (developmental path)
    LimbForelimb Dorsal MusclesMononuclear MyocytesSkeletal Muscle
    LimbForelimb Ventral MusclesMononuclear MyocytesSkeletal Muscle
    LimbHindlimb Dorsal MuscleMononuclear MyocytesSkeletal Muscle
    LimbHindlimb Ventral MuscleMononuclear MyocytesSkeletal Muscle
    Skeletal MuscleThoracic Epaxial MyotomeMononuclear MyocytesSkeletal Muscle
    SomiteCervical Epaxial MyotomeMononuclear MyocytesSkeletal Muscle
    SomiteCervical Hypaxial MyotomeMononuclear MyocytesSkeletal Muscle
    SomiteCervical Primary Epaxial MyotomeMononuclear MyocytesSkeletal Muscle
    SomiteCervical Primary Hypaxial MyotomeMononuclear MyocytesSkeletal Muscle
    SomiteLumbar Epaxial MyotomeMononuclear MyocytesSkeletal Muscle
    Expression: Positive    Negative     Selective marker
    Experimental details: Curated     Microarrays     In-situ hybridization
    Stem Cell Differentiation: 1 LifeMap Cell 
    NameCategory
    Sclerotome cells (Primary Cell)Bone, Cartilage, Somite

    See TRIO Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for TRIO

    SOURCE GeneReport for Unigene cluster: Hs.130031

    UniProtKB/Swiss-Prot: TRIO_HUMAN, O75962
    Tissue specificity: Highly expressed in heart, skeletal muscle, brain, pancreas, placenta, liver, kidney and lung

        SABiosciences Custom PCR Arrays for TRIO
    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for TRIO
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat TRIO
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIO
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIO
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIO

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of animals.

    Orthologs for TRIO gene from 6/19 species (see all 19)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Trio1 , 5 triple functional domain (PTPRF interacting)1, 5 89.12(n)1
    96.58(a)1
      15 (10.40 cM)5
    2234351  NM_001081302.11  NP_001074771.11 
     277306525 
    chicken
    (Gallus gallus)
    Aves TRIO1 triple functional domain (PTPRF interacting) 83.23(n)
    95.07(a)
      420919  XM_419004.3  XP_419004.3 
    African clawed frog
    (Xenopus laevis)
    Amphibia Xl.239552 Xenopus laevis transcribed sequence with moderate similarity more 74.61(n)    CB564898.1 
    zebrafish
    (Danio rerio)
    Actinopterygii si:dkey-158b13.21 si:dkey-158b13.2 75.92(n)
    84.06(a)
      557667  NM_001104526.1  NP_001097996.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta trio1 , 3 Rho protein signal transduction Rho
    guanyl-nucleotide more3
    CG18214-PA1
    43(a)3
    53.87(n)1
    47.42(a)1
      439741  NM_167847.21  NP_728560.11 
    worm
    (Caenorhabditis elegans)
    Secernentea unc-731 , 3 guanine nucleotide exchange factor3
    Protein UNC-731
    27(a)3
    44.05(n)1
    31.96(a)1
      I(3999350-4031628)3
    1719881  NM_001026325.11  NP_001021496.11 


    ENSEMBL Gene Tree for TRIO (if available)
    TreeFam Gene Tree for TRIO (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for TRIO gene
    KALRN2  ARHGEF252  PLEKHG4B2  MCF2L22  MCF2L2  KIAA17552  PLEKHG42  MCF22  
    ARHGEF402  
    18/23 SIMAP similar genes for TRIO using alignment to 5 protein entries:     TRIO_HUMAN (see all proteins) (see all similar genes):
    tgat    KALRN    STK17B    ARHGEF25    GEFT    SESTD1
    DAPK3    STK17A    MCF2L2    MCF2L    DAPK2    MARK4
    NUAK1    PNCK    PRKAA1    PRKACB    CAMK1D    KIN27

    TRIO for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/6651 NCBI SNPs in TRIO are shown (see all 6651    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 5 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1523831,2
    C,H,--14141837(+) GTATCT/CACATA 1 -- us2k112Minor allele frequency- C:0.28NA WA CSA EA 373
    rs1523821,2
    C,F,A,--14141967(+) TATGGA/TCTCAT 1 -- us2k18Minor allele frequency- T:0.29WA NA CSA EA 368
    rs1846472061,2
    --14142456(+) CTCCAA/GCTCTA 1 -- us2k10--------
    rs38490821,2
    C,F,A,H,--14142643(+) CTGGAT/ACCTTT 1 -- us2k113Minor allele frequency- A:0.19MN NS EA NA CSA WA 848
    rs1439884691,2
    --14143045(+) CCTTGA/CGGGCT 1 -- us2k10--------
    rs131807411,2
    C--14143354(+) AGCCCC/TTCTTT 1 -- us2k1 tfbs3 trp30--------
    rs131807431,2
    C--14143356(+) CCCCTC/TTTTTT 1 -- us2k1 trp30--------
    rs1895587651,2
    --14143364(+) TTTTTC/TCCTTC 1 -- us2k10--------
    rs117495161,2
    C,H--14144117(+) CCGCAA/GGCTCT 1 -- int10--------
    rs2494931,2
    C,F,A,--14144399(+) CCGAGC/GGGACT 1 -- int18Minor allele frequency- G:0.41MN NA WA CSA EA 549

    HapMap Linkage Disequilibrium report for TRIO (14143811 - 14393811 bp, first 250kb of TRIO)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
    Database of Genomic Variants (DGV): 8 variations for TRIO
         5 CNVs: 69013 37941 69014 8480 51577
         3 Indels: 80833 46780 92892
    Human Gene Mutation Database (HGMD): TRIO

    SABiosciences Cancer Mutation PCR Assays
    1 SABiosciences qBiomarker Copy Number PCR Array containing TRIO:
    Oncogenes & Tumor Suppressor Genes 384HC
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing TRIO
    DNA2.0 Custom Variant and Variant Library Synthesis for TRIO

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    TRIO for disorders           About GeneDecksing

    OMIM gene information: 601893    OMIM disorders: --

    15 diseases for TRIO:    About MalaCards
    soft tissue sarcoma    urinary bladder cancer    toxic encephalopathy    esophageal squamous cell carcinoma
    squamous cell carcinoma    gout    spasticity    sarcoma
    esophagitis    breast cancer    glioblastoma    carcinoma
    schizophrenia    neuronitis    alcoholism

    Human Genome Epidemiology (HuGE) Navigator: TRIO (109 documents)

    Export disorders for TRIO gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for TRIO gene, integrated from 9 sources (see all 64):
    (articles sorted by number of sources associating them with TRIO)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac- specific and rho-specific guanine nucleotide exchange factor domains. (PubMed id 8643598)1, 2, 3 Debant A....Streuli M. (1996)
    2. NMR structure and mutagenesis of the N-terminal Dbl homology domain of the nucleotide exchange factor Trio. (PubMed id 9790533)1, 2, 9 Liu X.... Fesik S.W. (1998)
    3. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PubMed id 17081983)1, 2 Olsen J.V....Mann M. (2006)
    4. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    6. Trio amino-terminal guanine nucleotide exchange factor domain expression promotes actin cytoskeleton reorganization, cell migration and anchorage-independent cell growth. (PubMed id 10341202)1, 2 Seipel K.... Streuli M. (1999)
    7. The trio guanine nucleotide exchange factor is a RhoA target. Binding of RhoA to the trio immunoglobulin-like domain. (PubMed id 10948190)1, 9 Medley Q.G....Streuli M. (2000)
    8. The DH and PH domains of Trio coordinately engage Rho GTPases for their efficient activation. (PubMed id 17391702)1, 9 Chhatriwala M.K....Sondek J. (2007)
    9. Identification of novel neuronal isoforms of the Rho-GEF Trio. (PubMed id 16033331)1, 9 Portales-Casamar E....Debant A. (2006)
    10. Galphaq directly activates p63RhoGEF and Trio via a conserved extension of the Dbl homology-associated pleckstrin homology domain. (PubMed id 17606614)1, 9 Rojas R.J.... Sondek J. (2007)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 7204 HGNC: 12303 AceView: TRIO Ensembl:ENSG00000038382 euGenes: HUgn7204
    ECgene: TRIO H-InvDB: TRIO

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for TRIO Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for TRIO gene:
    Search GeneIP for patents involving TRIO

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     Browse OriGene Antibodies   Browse OriGene shRNA RFPs  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for TRIO   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for TRIO  
     Browse OriGene Protein Over-expression Lysates   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for TRIO   OriGene 3'-UTR Clone for TRIO  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for TRIO   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for TRIO  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for TRIO   OriGene Custom Protein Services for TRIO  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat TRIO
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing TRIO
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat TRIO
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIO
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIO
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIO
     GenScript Custom Purified and Recombinant Proteins Services for TRIO GenScript cDNA clones with any tag delivered in your preferred vector for TRIO
     GenScript Custom Assay Services for TRIO GenScript Superior Antibodies for TRIO
     GenScript Custom overexpressing Cell Line Services for TRIO CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in TRIO promoter
     Search Chromatin IP Primers for TRIO
     RT2 qPCR Primer Assay in human, mouse, rat TRIO
     GNC Network for TRIO
     SABiosciences PCR Arrays including human, mouse, rat TRIO
     Tocris compounds for TRIO
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     TRIO antibodies
     TRIO proteins
     Search for Antibodies for TRIO at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for TRIO
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     TRIO Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for TRIO
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIO
     SwitchGear 3'UTR luciferase reporter plasmids for TRIO
     SwitchGear Promoter luciferase reporter plasmids for TRIO
     Search ThermoFisher Antibodies for TRIO
     Search Vector BioLabs for ready-to-use adenovirus/AAV for human, mouse, rat TRIO
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      TRIO gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4