Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

TRIO Gene

protein-coding   GIFtS: 67
GCID: GC05P014143

Trio Rho Guanine Nucleotide Exchange Factor

(Previous name: triple functional domain (PTPRF interacting))
  See related diseases
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

Aliases
Trio Rho Guanine Nucleotide Exchange Factor1 2     ARHGEF232
Triple Functional Domain (PTPRF Interacting)1 2     tgat2
PTPRF-Interacting Protein2 3     Triple Functional Domain Protein2
EC 2.7.11.13 8     

External Ids:    HGNC: 123031   Entrez Gene: 72042   Ensembl: ENSG000000383827   OMIM: 6018935   UniProtKB: O759623   

Export aliases for TRIO gene to outside databases

Previous GC identifers: GC05U990059 GC05P014425 GC05P014176 GC05P014196


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

GeneCards Summary for TRIO Gene: 
TRIO (trio Rho guanine nucleotide exchange factor) is a protein-coding gene. Diseases associated with TRIO include toxic encephalopathy, and soft tissue sarcoma, and among its related super-pathways are NRAGE signals death through JNK and Signaling by GPCR. GO annotations related to this gene include protein serine/threonine kinase activity and guanyl-nucleotide exchange factor activity. An important paralog of this gene is KALRN.

UniProtKB/Swiss-Prot: TRIO_HUMAN, O75962
Function: Promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could
play a role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell
growth

Gene Wiki entry for TRIO Gene


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 73), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000005.9  NT_006576.16  NC_018916.2  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the TRIO gene promoter:
         Elk-1   Pbx1a   GATA-3   Egr-1   C/EBPalpha   GATA-1   GATA-2   Egr-4   AREB6   ATF6   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): TRIO promoter sequence
   Search SABiosciences Chromatin IP Primers for TRIO

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat TRIO


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 5p15.2   Ensembl cytogenetic band:  5p15.2   HGNC cytogenetic band: 5p14-p15.1

TRIO Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
TRIO gene location

GeneLoc information about chromosome 5         GeneLoc Exon Structure

GeneLoc location for GC05P014143:  view genomic region     (about GC identifiers)

Start:
14,143,811 bp from pter      End:
14,532,235 bp from pter
Size:
388,425 bases      Orientation:
plus strand

(According to UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MAXQB RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Ontologies according to Gene Ontology Consortium 01 Oct 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

UniProtKB/Swiss-Prot: TRIO_HUMAN, O75962 (See protein sequence)
Recommended Name: Triple functional domain protein  
Size: 3097 amino acids; 346900 Da
Subunit: Interacts to form a complex with leukocyte antigen related protein
Subcellular location: Cytoplasm (By similarity)
Sequence caution: Sequence=AAC34245.1; Type=Erroneous initiation; Note=Translation N-terminally extended;
Sequence=AAC34245.1; Type=Frameshift; Positions=2301; Sequence=AAC43042.1; Type=Erroneous initiation;
2 PDB 3D structures from and Proteopedia for TRIO:
1NTY (3D)        2NZ8 (3D)    
Secondary accessions: D3DTD1 Q13458 Q59EQ7 Q6PJC9 Q6ZN05 Q8IWK8
Alternative splicing: 5 isoforms:  O75962-1   O75962-2   O75962-3   O75962-4   O75962-5   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for TRIO: NX_O75962

Explore proteomics data for TRIO at MOPED 

Post-translational modifications:

  • UniProtKB: Phosphorylated on serine residue(s)
  • View modification sites using PhosphoSitePlus
  • View neXtProt modification sites for NX_O75962

  • 18 DME Specific Peptides for TRIO (O75962) (see first 4)
     DPCKFAL  SPIEYQR  KYQLLLK  ELNEEKR 
     RRKHQND  ANYSKAVH  FLQLRIFE  QRENRVLH 
     GHYASQQI  LSGVSPFLD  VCKRGFTVI  LLDMSVSFHTH 
     KTHQSALQVQQKAE  IHVALIIKPDNFWQKQ  IWQHRKVRLHQRLQLCVFQQ  LDQCFQLRLFEQDAEKMFDWI 
     KRRLDQCQQYVVFERSAKQAL  NIFLKELEKYEQLPEDVGHCFVTWADKFQMYV 

    TRIO Protein expression data from MOPED1, PaxDb2 and MAXQB3 :    About this image 

    TRIO Protein Expression
    REFSEQ proteins: NP_009049.2  
    ENSEMBL proteins: 
     ENSP00000339299   ENSP00000421555   ENSP00000445592   ENSP00000426342   ENSP00000339291  
     ENSP00000446348  
    Reactome Protein details: O75962
    Human Recombinant Protein Products for TRIO: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    Browse OriGene Protein Over-expression Lysates
    OriGene Custom MassSpec 
    OriGene Custom Protein Services for TRIO
    GenScript Custom Purified and Recombinant Proteins Services for TRIO
    Novus Biologicals TRIO Protein
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates 
    Browse ProSpec Recombinant Proteins
    Cloud-Clone Corp. Proteins for TRIO 

    Gene Ontology (GO): 3 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005622intracellular ----
    GO:0005829cytosol TAS--
    GO:0016020membrane ----

    TRIO for ontologies           About GeneDecksing



    TRIO Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for TRIO
    GenScript Superior Antibodies for TRIO
    Novus Biologicals TRIO Antibodies
    Abcam antibodies for TRIO
    Cloud-Clone Corp. Antibodies for TRIO 
    Search ThermoFisher Antibodies for TRIO
    LSBio Antibodies in human, mouse, rat for TRIO 

    Assay Products for TRIO: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for TRIO
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for TRIO
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for TRIO 
    Cloud-Clone Corp. CLIAs for TRIO


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section
    HGNC Gene Families: 
    ISET: Immunoglobulin superfamily / I-set domain containing
    ARHGEF: Rho guanine nucleotide exchange factors

    IUPHAR Guide to PHARMACOLOGY protein family classification: trio Rho guanine nucleotide exchange factor 
    Trio family

    5/15 InterPro protein domains (see all 15):
     IPR003598 Ig_sub2
     IPR007110 Ig-like_dom
     IPR002017 Spectrin_repeat
     IPR002290 Ser/Thr_dual-sp_kinase_dom
     IPR000219 DH-domain

    Graphical View of Domain Structure for InterPro Entry O75962

    ProtoNet protein and cluster: O75962

    5/7 Blocks protein domains (see all 7):
    IPB000219 DH domain
    IPB001251 Cellular retinaldehyde-binding (CRAL)/Triple function domain (TRIO)
    IPB001849 Pleckstrin-like
    IPB002017 Spectrin repeat
    IPB003598 Immunoglobulin C-2 type


    UniProtKB/Swiss-Prot: TRIO_HUMAN, O75962
    Domain: The N-terminal DBL/GEF domain specifically catalyzes nucleotide exchange for RAC1, leading to the
    activation of Jun kinase and the production of membrane ruffles. The second DBL/GEF domain is an exchange factor
    for rhoa and induces the formation of stress fibers
    Similarity: Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family
    Similarity: Contains 1 CRAL-TRIO domain
    Similarity: Contains 2 DH (DBL-homology) domains
    Similarity: Contains 1 Ig-like C2-type (immunoglobulin-like) domain
    Similarity: Contains 2 PH domains
    Similarity: Contains 1 protein kinase domain
    Similarity: Contains 2 SH3 domains
    Similarity: Contains 4 spectrin repeats


    TRIO for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase, shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Sirion Biotech, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, Vector BioLabs, and Sirion Biotech, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene.)
    About This Section

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: TRIO_HUMAN, O75962
    Function: Promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could
    play a role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell
    growth
    Catalytic activity: ATP + a protein = ADP + a phosphoprotein

         Genatlas biochemistry entry for TRIO:
    trio phosphoprotein,with three enzymze domains,binding the LAR transmembrane tyrosine phosphatase (PTPRF),likely
    involved in active cell migration

         Enzyme Number (IUBMB): EC 2.7.11.11 2

         Gene Ontology (GO): 5/10 molecular function terms (GO ID links to tree view) (see all 10):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004672protein kinase activity ----
    GO:0004674protein serine/threonine kinase activity IEA--
    GO:0004713protein tyrosine kinase activity ----
    GO:0005085guanyl-nucleotide exchange factor activity TAS8643598
    GO:0005089Rho guanyl-nucleotide exchange factor activity IEA--
         
    TRIO for ontologies           About GeneDecksing


    Phenotypes:
         1 GenomeRNAi human phenotype for TRIO:
     Increased colony dispersion (i 

         6 MGI mutant phenotypes (inferred from 2 alleles(MGI details for Trio):
     behavior/neurological  cellular  growth/size  mortality/aging  muscle 
     nervous system 

    TRIO for phenotypes           About GeneDecksing

    Animal Models:
         MGI mouse knock-out Triotm1Mst for TRIO

       inGenious Targeting Laboratory - Custom generated mouse model solutions for TRIO 
       inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for TRIO

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for TRIO 
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for TRIO 

    miRNA
    Products:
        
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat TRIO
    8/28 QIAGEN miScript miRNA Assays for microRNAs that regulate TRIO (see all 28):
    hsa-miR-21* hsa-miR-448 hsa-miR-3673 hsa-miR-4311 hsa-miR-300 hsa-miR-429 hsa-miR-125a-3p hsa-miR-25
    SwitchGear 3'UTR luciferase reporter plasmidTRIO 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for TRIO
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIO

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for TRIO


    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene clones in human, mouse for TRIO (see all 5)
    OriGene ORF clones in mouse, rat for TRIO
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: TRIO (NM_007118)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIO
    Search Vector BioLabs for ready-to-use adenovirus/AAV for human, mouse, rat TRIO

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for TRIO
    Search LifeMap BioReagents cell lines for TRIO
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIO


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene).
    About This Section

    SuperPaths for TRIO About   (see all 12)                                                                                              See pathways by source

    SuperPathContained pathways About
    1Cell death signalling via NRAGE, NRIF and NADE
    Cell death signalling via NRAGE, NRIF and NADE0.74
    p75 NTR receptor-mediated signalling0.73
    NRAGE signals death through JNK0.74
    G alpha (12/13) signalling events0.46
    2Signaling by GPCR
    Signaling by GPCR0.90
    Signal Transduction0.55
    GPCR downstream signaling0.90
    3G alpha (q) signalling events
    Gastrin-CREB signalling pathway via PKC and MAPK0.90
    G alpha (q) signalling events0.90
    4TRKA Signaling
    TRKA Signaling0.75
    NGF Pathway0.75
    5Axon guidance
    Axon guidance0.69
    Developmental Biology0.69

    Pathways by source                                                                                                                                                                 See SuperPaths
    Show all pathways

    1 EMD Millipore Pathway for TRIO
        Cytoskeleton remodeling Integrin outside-in signaling

    2 Downloadable PowerPoint Slides of QIAGEN Pathway Central Maps for TRIO
        NGF Pathway
    TRKA Signaling

    1 GeneGo (Thomson Reuters) Pathway for TRIO
        Cytoskeleton remodeling Integrin outside-in signaling

    3 BioSystems Pathways for TRIO
        Regulation of RhoA activity
    Regulation of RAC1 activity
    Regulation of Microtubule Cytoskeleton

    5/16        Reactome Pathways for TRIO (see all 16)
        Signaling by Rho GTPases
    GPCR downstream signaling
    Developmental Biology
    G alpha (12/13) signalling events
    Gastrin-CREB signalling pathway via PKC and MAPK



    TRIO for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for TRIO

    STRING Interaction Network Preview (showing 5 interactants - click image to see 16)

    5/21 Interacting proteins for TRIO (O759621, 2, 3 ENSP000003392994) via UniProtKB, MINT, STRING, and/or I2D (see all 21)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    BLMHQ138672, 3, ENSP000002617144MINT-64162 I2D: score=5 STRING: ENSP00000261714
    DISC1Q9NRI51, 3, ENSP000003555964EBI-718519,EBI-529989 I2D: score=2 STRING: ENSP00000355596
    RHOAP615863, ENSP000004001754I2D: score=3 STRING: ENSP00000400175
    PHLDA3Q9Y5J53, ENSP000003562784I2D: score=1 STRING: ENSP00000356278
    RAC1P630003, ENSP000003484614I2D: score=3 STRING: ENSP00000348461
    About this table

    Gene Ontology (GO): 5/10 biological process terms (GO ID links to tree view) (see all 10):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006468protein phosphorylation ----
    GO:0007185transmembrane receptor protein tyrosine phosphatase signaling pathway TAS8643598
    GO:0007264small GTPase mediated signal transduction TAS--
    GO:0007411axon guidance TAS--
    GO:0009103lipopolysaccharide biosynthetic process ----

    TRIO for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    TRIO for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Compounds for TRIO available from Tocris Bioscience    About this table
    CompoundAction CAS #
    HJC 0350Selective Epac2 inhibitor[885434-70-8]
    Dynamin inhibitory peptide, myristoylated (control) Control peptide version of dynamin inhibitory peptide, myristoylated (Cat. No. 1775) --
    8CPT-2Me-cAMP, sodium salt Selective Epac activator[510774-50-2]
    DynasoreNon-competitive dynamin inhibitor[304448-55-3]
    ML 141Selective inhibitor of Cdc42 Rho family GTPase[71203-35-5]

    1 HMDB Compound for TRIO    About this table
    CompoundSynonyms CAS #PubMed Ids
    Guanosine triphosphate5'-GTP (see all 10)86-01-1--

    2 Novoseek inferred chemical compound relationships for TRIO gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    gdp 67.9 2 18505730 (1), 12475976 (1)
    gtp 60.8 6 18505730 (1), 12475976 (1)

    Search CenterWatch for drugs/clinical trials and news about TRIO

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Sirion Biotech, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for TRIO gene: 
    NM_007118.2  

    Unigene Cluster for TRIO:

    Trio Rho guanine nucleotide exchange factor
    Hs.130031  [show with all ESTs]
    Unigene Representative Sequence: NM_007118
    18/24 Ensembl transcripts including schematic representations, and UCSC links where relevant (see all 24):
    ENST00000505971 ENST00000502816 ENST00000344204(uc003jff.3 uc003jfg.3)
    ENST00000512070 ENST00000509967(uc011cna.1) ENST00000504606 ENST00000513206
    ENST00000515144(uc003jfh.1) ENST00000510757 ENST00000502490 ENST00000509354
    ENST00000512303 ENST00000512979 ENST00000507714 ENST00000515710 ENST00000506611
    ENST00000511019 ENST00000510281
    miRNA
    Products:
         
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat TRIO
    8/28 QIAGEN miScript miRNA Assays for microRNAs that regulate TRIO (see all 28):
    hsa-miR-21* hsa-miR-448 hsa-miR-3673 hsa-miR-4311 hsa-miR-300 hsa-miR-429 hsa-miR-125a-3p hsa-miR-25
    SwitchGear 3'UTR luciferase reporter plasmidTRIO 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for TRIO
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIO
    Clone
    Products:
         
    OriGene clones in human, mouse for TRIO (see all 5)
    OriGene ORF clones in mouse, rat for TRIO
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: TRIO (NM_007118)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIO
    Search Vector BioLabs for ready-to-use adenovirus/AAV for human, mouse, rat TRIO
    Primer
    Products:
        
    OriGene qSTAR qPCR primer pairs in human, mouse for TRIO
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat TRIO
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIO
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIO

    Additional mRNA sequence: 

    AB115332.1 AB209754.1 AF091395.1 AK131423.1 AK304786.1 AL161955.1 BC017268.2 BC035585.1 
    U42390.1 

    24/30 DOTS entries (see all 30):

    DT.317209  DT.99952185  DT.91928318  DT.100748128  DT.99952587  DT.97795856  DT.412418  DT.91955186 
    DT.120798656  DT.99961039  DT.120798475  DT.75101160  DT.101966737  DT.86835808  DT.120798724  DT.100748127 
    DT.120798576  DT.91693359  DT.92442539  DT.120798653  DT.120798659  DT.92043783  DT.92442543  DT.97789826 

    24/383 AceView cDNA sequences (see all 383):

    BM722637 AW014382 AW204990 AK131423 AW502049 AI434405 CD517575 AW771524 
    AI220818 AI922112 AA253137 BC035585 CA771768 BG034846 BE671819 BX092203 
    BX111226 BQ018458 AI651284 CD623729 BX644821 AA278236 BE042964 BQ774160 

    GeneLoc Exon Structure

    5/17 Alternative Splicing Database (ASD) splice patterns (SP) for TRIO (see all 17)    About this scheme

    ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^ 22 ^ 23 ^
    SP1:              -                       -                                                                                                                     
    SP2:              -                       -                                                                                                                     
    SP3:                                                                                                                                                            
    SP4:                                      -                                                                                                                     
    SP5:                                                                                                                                                            

    ExUns: 24 ^ 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31 ^ 32 ^ 33 ^ 34a · 34b ^ 35 ^ 36a · 36b · 36c ^ 37 ^ 38a · 38b ^ 39a · 39b · 39c ^ 40a · 40b ^ 41 ^ 42 ^
    SP1:                                                              -           -                       -                                         -               
    SP2:                                                              -           -                       -                                         -               
    SP3:                                                              -           -                       -                                         -               
    SP4:                                                              -           -                                                                                 
    SP5:                                                                                                                                                            

    ExUns: 43 ^ 44 ^ 45a · 45b ^ 46 ^ 47 ^ 48a · 48b ^ 49a · 49b ^ 50 ^ 51a · 51b ^ 52a · 52b · 52c · 52d ^ 53a · 53b ^ 54a · 54b ^ 55 ^ 56a · 56b ^ 57a · 57b ^
    SP1:                                            -     -                       -     -     -     -     -     -                                               -   
    SP2:                                            -     -                             -     -     -     -     -                                               -   
    SP3:                                            -     -                                                                                                         
    SP4:                                                                                                                                                            
    SP5:                                                                                                  -     -                                               -   

    ExUns: 58 ^ 59a · 59b ^ 60 ^ 61a · 61b ·
    SP1:              -                     
    SP2:              -                     
    SP3:                                    
    SP4:                                    
    SP5:              -                     


    ECgene alternative splicing isoforms for TRIO

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TRIO expression in normal human tissues (normalized intensities)      TRIO embryonic expression: see
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: TTTACACAGT
    TRIO Expression
    About this image


    TRIO expression in embryonic tissues and stem cells    About this table
    Data from LifeMap, the Embryonic Development and Stem Cells Database 
     5/10 selected tissues (see all 10) fully expand
     
     Skeletal Muscle (Muscoskeletal System)    fully expand to see all 20 entries
             Mononuclear Myocytes Cervical Primary Hypaxial Myotome
     
     Somite (Muscoskeletal System)    fully expand to see all 16 entries
             Mononuclear Myocytes Cervical Primary Hypaxial Myotome
     
     Brain (Nervous System)    fully expand to see all 5 entries
             superior temporal gyrus   
     
     Limb (Muscoskeletal System)    fully expand to see all 4 entries
             Mononuclear Myocytes Hindlimb Dorsal Muscle
     
     Eye (Sensory Organs)    fully expand to see all 2 entries
             retinal amacrine cell p0   

    See TRIO Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for TRIO

    SOURCE GeneReport for Unigene cluster: Hs.130031

    UniProtKB/Swiss-Prot: TRIO_HUMAN, O75962
    Tissue specificity: Highly expressed in heart, skeletal muscle, brain, pancreas, placenta, liver, kidney and lung

        SABiosciences Custom PCR Arrays for TRIO
    Primer
    Products:
    OriGene qSTAR qPCR primer pairs in human, mouse for TRIO
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat TRIO
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIO
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIO
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIO

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of animals.

    Orthologs for TRIO gene from 7/15 species (see all 15)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Trio1 , 5 triple functional domain (PTPRF interacting)1, 5 89.12(n)1
    96.58(a)1
      15 (10.40 cM)5
    2234351  NM_001081302.11  NP_001074771.11 
     277306525 
    chicken
    (Gallus gallus)
    Aves TRIO1 triple functional domain (PTPRF interacting) 83.23(n)
    95.07(a)
      420919  XM_419004.3  XP_419004.3 
    lizard
    (Anolis carolinensis)
    Reptilia --
    --
    (see all 3)
    --
    93(a)
    90(a)
    (see all 3)
    many → 1
    many → 1
    (see all 3)
    4(61124871-61138144)
    4(61273581-61512842)
    African clawed frog
    (Xenopus laevis)
    Amphibia Xl.239552 Xenopus laevis transcribed sequence with moderate similarity more 74.61(n)    CB564898.1 
    zebrafish
    (Danio rerio)
    Actinopterygii si:dkey-158b13.21 si:dkey-158b13.2 75.92(n)
    84.06(a)
      557667  NM_001104526.1  NP_001097996.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta trio1 , 3 Rho protein signal transduction Rho
    guanyl-nucleotide more3
    CG18214-PA1
    43(a)3
    53.87(n)1
    47.42(a)1
      439741  NM_167847.21  NP_728560.11 
    worm
    (Caenorhabditis elegans)
    Secernentea unc-731 , 3 guanine nucleotide exchange factor3
    Protein UNC-731
    27(a)3
    44.05(n)1
    31.96(a)1
      I(3999350-4031628)3
    1719881  NM_001026325.11  NP_001021496.11 


    ENSEMBL Gene Tree for TRIO (if available)
    TreeFam Gene Tree for TRIO (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for TRIO gene
    KALRN2  ARHGEF252  MCF2L22  PLEKHG4B2  MCF2L2  KIAA17552  PLEKHG42  ARHGEF402  
    MCF22  
    18/22 SIMAP similar genes for TRIO using alignment to 5 protein entries:     TRIO_HUMAN (see all proteins) (see all similar genes):
    tgat    KALRN    ARHGEF25    STK17B    SESTD1    DAPK3
    STK17A    MCF2L2    MCF2L    DAPK2    MARK4    NUAK1
    PNCK    PRKAA1    PRKACB    CAMK1D    KIN27    MCF2

    TRIO for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/8080 SNPs in TRIO are shown (see all 8080)    About this table     
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 5 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    VAR_0419024
    A metastatic melanoma sample4--see VAR_0419022 V M mis40--------
    VAR_0693724
    ----see VAR_0693722 T M mis40--------
    VAR_0693714
    ----see VAR_0693712 D V mis40--------
    rs1523831,2
    C,F,H--14141837(+) gtatcT/Cacata 1 -- us2k112Minor allele frequency- C:0.28NA WA CSA EA 373
    rs1523821,2
    C,F,A--14141967(+) tatggA/Tctcat 1 -- us2k18Minor allele frequency- T:0.29WA NA CSA EA 368
    rs1846472061,2
    --14142456(+) CTCCAA/GCTCTA 1 -- us2k10--------
    rs38490821,2
    C,F,A,H--14142643(+) CTGGAT/ACCTTT 1 -- us2k113Minor allele frequency- A:0.19MN NS EA NA CSA WA 848
    rs1439884691,2
    --14143045(+) CCTTGA/CGGGCT 1 -- us2k10--------
    rs131807411,2
    C--14143354(+) AGCCCC/TTCTTT 1 -- us2k1 tfbs3 trp30--------
    rs131807431,2
    C--14143356(+) CCCCTC/TTTTTT 1 -- us2k1 trp30--------

    HapMap Linkage Disequilibrium report for TRIO (14143811 - 14393811 bp, first 250kb of TRIO)

    Structural Variations
         Database of Genomic Variants (DGV) 10/28 variations for TRIO (see all 28):    About this table     
    Variant IDTypeSubtypePubMed ID
    esv2410391CNV Deletion18987734
    esv2658101CNV Deletion23128226
    esv2729813CNV Deletion23290073
    esv2729810CNV Deletion23290073
    esv2729812CNV Deletion23290073
    esv2421652CNV Deletion20811451
    esv2729808CNV Deletion23290073
    esv2138858CNV Deletion18987734
    esv2729811CNV Deletion23290073
    esv2537252CNV Deletion19546169


    Human Gene Mutation Database (HGMD): TRIO
    SABiosciences Cancer Mutation PCR Assays
    1 SABiosciences qBiomarker Copy Number PCR Array containing TRIO:
    Oncogenes & Tumor Suppressor Genes 384HC
    SeqTarget long-range PCR primers for resequencing TRIO
    DNA2.0 Custom Variant and Variant Library Synthesis for TRIO

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section
    OMIM gene information: 601893    OMIM disorders: --

    13 diseases for TRIO:    About MalaCards
    toxic encephalopathy    soft tissue sarcoma    gout    spasticity
    esophageal squamous cell carcinoma    sarcoma    esophagitis    glioblastoma
    squamous cell carcinoma    alcoholism    schizophrenia    breast cancer
    neuronitis


    TRIO for disorders           About GeneDecksing

    Genetic Association Database (GAD): TRIO
    Human Genome Epidemiology (HuGE) Navigator: TRIO (109 documents)

    Export disorders for TRIO gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for TRIO gene, integrated from 9 sources (see all 70):
    (articles sorted by number of sources associating them with TRIO)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac- specific and rho-specific guanine nucleotide exchange factor domains. (PubMed id 8643598)1, 2, 3 Debant A....Streuli M. (1996)
    2. NMR structure and mutagenesis of the N-terminal Dbl homology domain of the nucleotide exchange factor Trio. (PubMed id 9790533)1, 2, 9 Liu X.... Fesik S.W. (1998)
    3. Mutation of ARHGAP9 in patients with coronary spastic angina. (PubMed id 19911011)1, 4 Takefuji M....Kaibuchi K. (2010)
    4. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PubMed id 20379614)1, 4 Rose J.E....Uhl G.R. (2010)
    5. Molecular genetics of successful smoking cessation: convergent genome-wide association study results. (PubMed id 18519826)1, 4 Uhl G.R....Lerman C. (2008)
    6. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PubMed id 17081983)1, 2 Olsen J.V....Mann M. (2006)
    7. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    8. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    9. Trio amino-terminal guanine nucleotide exchange factor domain expression promotes actin cytoskeleton reorganization, cell migration and anchorage-independent cell growth. (PubMed id 10341202)1, 2 Seipel K.... Streuli M. (1999)
    10. The trio guanine nucleotide exchange factor is a RhoA target. Binding of RhoA to the trio immunoglobulin-like domain. (PubMed id 10948190)1, 9 Medley Q.G....Streuli M. (2000)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 7204 HGNC: 12303 AceView: TRIO Ensembl:ENSG00000038382 euGenes: HUgn7204
    ECgene: TRIO H-InvDB: TRIO

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for TRIO Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for TRIO Genetics and Cytogenetics in Oncology and Haematology

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for TRIO gene:
    Search GeneIP for patents involving TRIO

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0 and Sirion Biotech, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Sirion Biotech, Cell lines from GenScript, and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Protease Activity Assays and Reagents   Browse Recombinant/Natural Proteins  
     Browse Stem Cell Products   Browse Tocris Biochemicals & Compounds  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     Browse OriGene Antibodies   OriGene RNAi products in human, mouse, rat for TRIO  
     Browse OriGene qPCR primer pairs and template standards   Browse OriGene Protein Over-expression Lysates  
     OriGene Custom Mass Spec   OriGene clones in human, mouse for TRIO  
     OriGene qSTAR qPCR primer pairs in human, mouse for TRIO   Browse OriGene full length recombinant human proteins expressed in human HEK293 cells  
     OriGene ORF clones in mouse, rat for TRIO   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for TRIO   OriGene Custom Protein Services for TRIO  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat TRIO
     QIAGEN SeqTarget long-range PCR primers for resequencing TRIO
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat TRIO
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIO
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIO
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIO
     GenScript Custom Purified and Recombinant Proteins Services for TRIO GenScript cDNA clones with any tag delivered in your preferred vector for TRIO
     GenScript Custom Assay Services for TRIO GenScript Superior Antibodies for TRIO
     GenScript Custom overexpressing Cell Line Services for TRIO CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in TRIO promoter
     Search Chromatin IP Primers for TRIO
     RT2 qPCR Primer Assay in human, mouse, rat TRIO
     GNC Network for TRIO
     SABiosciences PCR Arrays including human, mouse, rat TRIO
     Tocris compounds for TRIO
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological Cell Lysates
     Browse Sino Biological cDNA Clones
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     TRIO antibodies
     TRIO proteins
     Antibodies for TRIO
     See all of Abcam's Antibodies, Kits and Proteins for TRIO
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     Proteins for TRIO
     Antibodies for TRIO
     ELISAs for TRIO
     CLIAs for TRIO
     Search LifeMap BioReagents cell lines for TRIO
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIO
     SwitchGear 3'UTR luciferase reporter plasmids for TRIO
     SwitchGear Promoter luciferase reporter plasmids for TRIO
     Search ThermoFisher Antibodies for TRIO
     Search Vector BioLabs for ready-to-use adenovirus/AAV for human, mouse, rat TRIO
     inGenious Targeting Laboratory - Custom generated mouse model solutions for TRIO
     inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for TRIO
    Customized:
     lentivirus for stable overexpression
     lentivirus expression plasmids for stable overexpression
     adenovirus for overexpression
     LSBio Antibodies in human, mouse, rat for TRIO
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
           
    GeneCards Homepage - Last full update: 23 Oct 2013 - Incrementals: 4 Nov 2013 , 7 Nov 2013 , 23 Jan 2014

    View Random Gene

    Category
    (GIFtS: 73)
    transforming growth factor, beta 1
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      TRIO gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 106 solr: 1.4