Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 



TRIM50 Gene

protein-coding   GIFtS: 49
GCID: GC07M072726

Tripartite Motif Containing 50

(Previous names: tripartite motif-containing 50A, tripartite motif-containing...)
(Previous symbol: TRIM50A)
  Try our

disease database 

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

TryGeneCards Plus

Aliases
Tripartite Motif Containing 501 2     Tripartite Motif-Containing 501
TRIM50A1 2 3 5     E3 Ubiquitin-Protein Ligase TRIM502
Tripartite Motif-Containing 50A1 2     EC 6.3.2.-3
Tripartite Motif-Containing Protein 502 3     EC 6.3.28

External Ids:    HGNC: 190171   Entrez Gene: 1358922   Ensembl: ENSG000001467557   OMIM: 6125485   UniProtKB: Q86XT43   

Export aliases for TRIM50 gene to outside databases

Previous GC identifers: GC07M072124 GC07M072364 GC07M068608


(According to Entrez Gene, GeneCards, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

TryGeneCards Plus

GeneCards Summary for TRIM50 Gene:
TRIM50 (tripartite motif containing 50) is a protein-coding gene. GO annotations related to this gene include ligase activity. An important paralog of this gene is TRIM31.

UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4
Function: E3 ubiquitin-protein ligase




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 75), Regulatory elements and Epigenetics data according to QIAGEN, and/or SwitchGear Genomics)
About This Section

TryGeneCards Plus
RefSeq DNA sequence at NCBI GenBank:
NC_000007.13  NC_018918.2  NT_007933.16  
Regulatory elements:
   Regulatory transcription factor binding sites in the TRIM50 gene promoter:
         STAT1   STAT4   STAT1beta   STAT6   STAT5A   Tal-1beta   STAT1alpha   STAT2   STAT3   ITF-2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): TRIM50 promoter sequence
   Search Chromatin IP Primers for TRIM50

Epigenetics:
DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat TRIM50


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 7q11.23   Ensembl cytogenetic band:  7q11.23   HGNC cytogenetic band: 7q11.23

TRIM50 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
TRIM50 gene location

GeneLoc information about chromosome 7         GeneLoc Exon Structure

GeneLoc location for GC07M072726:  view genomic region     (about GC identifiers)

Start:
72,726,535 bp from pter      End:
72,742,085 bp from pter
Size:
15,551 bases      Orientation:
minus strand

1 alternative location:
Chr7-,CRA_TCAG 72,059,607-72,075,157     

(According to 1UniProtKB, HORDE, 2neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, Cloud-Clone Corp., and/or eBioscience,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, Cloud-Clone Corp., and/or eBioscience, Antibodies by EMD Millipore, R&D Systems, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, Cloud-Clone Corp, and/or others.)
About This Section

TryGeneCards Plus

UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4 (See protein sequence)
Recommended Name: E3 ubiquitin-protein ligase TRIM50  
Size: 487 amino acids; 54774 Da
Subunit: Can form dimers and trimers. Interacts with several E2 ubiquitin-conjugating enzymes, including UBE2L6,
UBE2E1, UBE2E3. No interaction with UBE2H
Secondary accessions: Q86XT3
Alternative splicing: 2 isoforms:  Q86XT4-1   Q86XT4-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for TRIM50: NX_Q86XT4

Explore proteomics data for TRIM50 at MOPED

Post-translational modifications: 

  • Auto-ubiquitinated1
  • Modification sites at neXtProt
  • Modification sites at PhosphoSitePlus
  • 2 DME Specific Peptides for TRIM50 (Q86XT4)
     YLHYEQGELTFFDADRPDDLR  LYTFQADFQGKLYPILDTCWHERGSNSLPMVLP 


    See TRIM50 Protein Expression from SPIRE MOPED, PaxDB, and MaxQB

    REFSEQ proteins (3 alternative transcripts): 
    NP_001268379.1  NP_001268380.1  NP_835226.2  

    ENSEMBL proteins: 
     ENSP00000327994   ENSP00000413875  

    TRIM50 Human Recombinant Protein Products:

    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate for TRIM50
    OriGene Custom MassSpec
    OriGene Custom Protein Services for TRIM50
    GenScript Custom Purified and Recombinant Proteins Services for TRIM50
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates
    Browse ProSpec Recombinant Proteins
    Cloud-Clone Corp. Proteins for TRIM50

     
    Search eBioscience for Proteins for TRIM50 

    TRIM50 Antibody Products:

    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for TRIM50
    Novus Biologicals TRIM50 Antibody
    Abcam antibodies for TRIM50
    Cloud-Clone Corp. Antibodies for TRIM50
    Search ThermoFisher Antibodies for TRIM50
    LSBio Antibodies in human, mouse, rat for TRIM50

    TRIM50 Assay Products:

    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for TRIM50
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for TRIM50
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for TRIM50
    Cloud-Clone Corp. CLIAs for TRIM50
    Search eBioscience for ELISAs for TRIM50 


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    TryGeneCards Plus
    HGNC Gene Families:
    TRIM: Tripartite motif containing / Tripartite motif containing
    RNF: RING-type (C3HC4) zinc fingers

    Selected InterPro protein domains (see all 9):
     IPR006574 PRY
     IPR017907 Znf_RING_CS
     IPR001841 Znf_RING
     IPR001870 B30.2/SPRY
     IPR003877 SPRY_rcpt

    Graphical View of Domain Structure for InterPro Entry Q86XT4

    ProtoNet protein and cluster: Q86XT4

    4 Blocks protein domains:
    IPB000315 B-box zinc finger signature
    IPB001841 Zn-finger
    IPB003879 Butyrophylin C-terminal DUF signature
    IPB006574 SPRY-associated domain


    UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4
    Similarity: Belongs to the TRIM/RBCC family
    Similarity: Contains 1 B box-type zinc finger
    Similarity: Contains 1 B30.2/SPRY domain
    Similarity: Contains 1 RING-type zinc finger


    Find genes that share domains with TRIM50           About GenesLikeMe


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    transcription factor targeting from QIAGEN and/or HOMER, miRNA Gene Targets from miRTarBase, shRNA from OriGene, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, SwitchGear Genomics, Gene Editing from DNA2.0, Clones from OriGene, GenScript, Sino Biological, DNA2.0, Vector BioLabs and/or Addgene, Cell Lines from GenScript, ESI BIO, In Situ Hybridization Assays from Advanced Cell Diagnostics, Flow cytometry from eBioscience, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: TRI50_HUMAN, Q86XT4
    Function: E3 ubiquitin-protein ligase

         Enzyme Numbers (IUBMB): EC 6.3.2.-1 EC 6.3.22

         Gene Ontology (GO): 4 molecular function terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005515protein binding ----
    GO:0008270zinc ion binding IEA--
    GO:0016874ligase activity IEA--
    GO:0046872metal ion binding ----
         
    Find genes that share ontologies with TRIM50           About GenesLikeMe


    Phenotypes:
         2 GenomeRNAi human phenotypes for TRIM50:
     G0/1 arrest  Increased S DNA content 

         2 MGI mutant phenotypes (inferred from 2 alleles(MGI details for Trim50):
     digestive/alimentary  no phenotypic analysis 

    Find genes that share phenotypes with TRIM50           About GenesLikeMe

    Animal Models:
         MGI mouse knock-out Trim50tm1Hta for TRIM50

       inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for TRIM50
       inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for TRIM50

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for TRIM50
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for TRIM50

    miRNA
    Products:
        
    miRTarBase miRNAs that target TRIM50:
    hsa-mir-335-5p (MIRT018041)

    Block miRNA regulation of human, mouse, rat TRIM50 using miScript Target Protectors
    Search for qRT-PCR Assays for microRNAs that regulate TRIM50
    SwitchGear 3'UTR luciferase reporter plasmidTRIM50 3' UTR sequence
    Inhib. RNA
    Products:
        
    OriGene RNAi products in human, mouse, rat for TRIM50
    Predesigned siRNA for gene silencing in human, mouse, rat TRIM50

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for TRIM50

    Clone
    Products:
         
    OriGene clones in human, mouse for TRIM50 (see all 6)
    OriGene ORF clones in mouse, rat for TRIM50
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: TRIM50 (NM_178125)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIM50
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat TRIM50

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for TRIM50
    Browse ESI BIO Cell Lines and PureStem Progenitors for TRIM50 
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIM50


    (According to UniProtKB, COMPARTMENTS Subcellular localization database, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Subcellular locations from UniProtKB/Swiss-Prot
    TRI50_HUMAN, Q86XT4: Cytoplasm
    Subcellular locations from COMPARTMENTS: 

    CompartmentConfidence
    nucleus3
    cytosol2

    Gene Ontology (GO): 3 cellular component terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005622intracellular ----
    GO:0005737cytoplasm IEA--
    GO:0043231intracellular membrane-bounded organelle ----

    Find genes that share ontologies with TRIM50           About GenesLikeMe


    (SuperPaths according to PathCards, Pathways according to R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to QIAGEN, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene).
    About This Section

    TryGeneCards Plus



        Custom Pathway & Disease-focused RT2 Profiler PCR Arrays for TRIM50
    Interactions:

        Search GeneGlobe Interaction Network for TRIM50

    STRING Interaction Network Preview (showing 5 interactants - click image to see 8)

    Selected Interacting proteins for TRIM50 (ENSP000003279944) via UniProtKB, MINT, STRING, and/or I2D (see all 8)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    UBE2D1ENSP000003630194STRING: ENSP00000363019
    UBE2D2ENSP000003817174STRING: ENSP00000381717
    UBE2D3ENSP000003497224STRING: ENSP00000349722
    UBE2D4ENSP000002224024STRING: ENSP00000222402
    UBE2E1ENSP000003037094STRING: ENSP00000303709
    About this table

    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience, ApexBio, HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB)
    About This Section

    TryGeneCards Plus
    Browse Small Molecules at EMD Millipore
       Browse drugs & compounds from Enzo Life Sciences
      Browse compounds at ApexBio 

    Browse Tocris compounds for TRIM50 (TRI50)



    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN, SwitchGear Genomics,
    Tagged/untagged cDNA clones from OriGene, GenScript, DNA2.0, Vector BioLabs, and/or Addgene, Primers from OriGene, and/or QIAGEN, Flow cytometry from eBioscience )
    About This Section

    TryGeneCards Plus

    REFSEQ mRNAs for TRIM50 gene (3 alternative transcripts): 
    NM_001281450.1  NM_001281451.1  NM_178125.3  

    Unigene Cluster for TRIM50:

    Tripartite motif containing 50
    Hs.647053  [show with all ESTs]
    Unigene Representative Sequence: AY081948
    4 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000333149(uc010lbd.1 uc003txy.1 uc003txz.1) ENST00000453152
    ENST00000488217 ENST00000493498
    miRNA
    Products:
         
    Block miRNA regulation of human, mouse, rat TRIM50 using miScript Target Protectors
    Search for qRT-PCR Assays for microRNAs that regulate TRIM50
    SwitchGear 3'UTR luciferase reporter plasmidTRIM50 3' UTR sequence
    Inhib. RNA
    Products:
         
    OriGene RNAi products in human, mouse, rat for TRIM50
    Predesigned siRNA for gene silencing in human, mouse, rat TRIM50
    Clone
    Products:
         
    OriGene clones in human, mouse for TRIM50 (see all 6)
    OriGene ORF clones in mouse, rat for TRIM50
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: TRIM50 (NM_178125)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIM50
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat TRIM50
    Primer
    Products:
        
    OriGene qSTAR qPCR primer pairs in human, mouse for TRIM50
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat TRIM50
      QuantiTect SYBR Green Assays in human, mouse, rat TRIM50
      QuantiFast Probe-based Assays in human, mouse, rat TRIM50

    Additional mRNA sequence: 

    AK057366.1 AK292074.1 AY081948.1 AY081949.1 BC112152.1 BC112154.1 BC143787.1 

    8 DOTS entries:

    DT.40233928  DT.443249  DT.92417013  DT.40131438  DT.75101643  DT.75115935  DT.100736906  DT.440570 

    Selected AceView cDNA sequences (see all 31):

    AW058675 NM_178125 AY081949 AY081948 AI675279 BE466482 AI928331 AI310113 
    AW614271 AI306456 AI916523 BX100375 AW299621 AA621610 BG413566 AK057366 
    AI768759 AI949449 AW296619 AI307283 AA844922 AI027904 AI208986 BG413545 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MaxQB, plus additional links to SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from QIAGEN, Primers from OriGene, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TryGeneCards Plus

    TRIM50 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: TATACCTTTT
    TRIM50 Expression
    About this image

    TRIM50 Protein expression data from MOPED1, PaxDb2 and MaxQB3    About this image

    TRIM50 Protein Expression

    SOURCE GeneReport for Unigene cluster: Hs.647053
        Custom PCR Arrays for TRIM50
    Primer
    Products:
    OriGene qSTAR qPCR primer pairs in human, mouse for TRIM50
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat TRIM50
    QuantiTect SYBR Green Assays in human, mouse, rat TRIM50
    QuantiFast Probe-based Assays in human, mouse, rat TRIM50
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIM50

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    TryGeneCards Plus

    This gene was present in the common ancestor of chordates.

    Orthologs for TRIM50 gene from Selected species (see all 8)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Trim501 , 5 tripartite motif-containing 501, 5 84.4(n)1
    89.1(a)1
      5 (75.15 cM)5
    2150611  NM_178240.21  NP_839971.11 
     1353532955 
    chicken
    (Gallus gallus)
    Aves TRIM501 tripartite motif containing 50 66.47(n)
    59.11(a)
      417461  XM_415709.3  XP_415709.3 
    lizard
    (Anolis carolinensis)
    Reptilia --
    Uncharacterized protein
    27(a)
    many ↔ many
    2(139794976-139814132)
    tropical clawed frog
    (Xenopus tropicalis)
    Amphibia trim501 tripartite motif containing 50 59.48(n)
    57.08(a)
      100495882  XM_004914882.1  XP_004914939.1 


    ENSEMBL Gene Tree for TRIM50 (if available)
    TreeFam Gene Tree for TRIM50 (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section

    TryGeneCards Plus
    Paralogs for TRIM50 gene
    TRIM312  TRIM102  TRIM732  TRIM692  TRIM152  TRIM262  TRIM742  TRIM352  
    TRIM522  TRIM622  TRIM412  TRIM722  
    11 SIMAP similar genes for TRIM50 using alignment to 3 protein entries:     TRI50_HUMAN (see all proteins):
    TRIM73    TRIM74    MEFV    TRIM39    TRIM5    BRCA1
    TRIM72    BT3.3    BTNL9    TRIM61    TRIM62

    Find genes that share paralogs with TRIM50           About GenesLikeMe



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD), the Human Cytochrome P450 Allele Nomenclature Database, and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers, Cancer Mutation PCR Arrays and Assays, and Copy Number PCR Arrays from QIAGEN)
    About This Section

    TryGeneCards Plus

    Selected SNPs for TRIM50 (see all 328)    About this table                                 

    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 7 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1456771831,2
    Cuntested172730580(+) TTCCGA/C/GAAGAG 2 F syn11NA 4550
    rs1491498271,2
    --72726061(+) CTCAGA/GAGGCT 1 -- ds50010--------
    rs1855337321,2
    --72726143(+) CCTGGC/GTGACA 1 -- ds50010--------
    rs1432832771,2
    --72726200(+) GCTCAC/TGCCTG 1 -- ds50010--------
    rs1904049561,2
    --72726283(+) CACAGC/TGAAAC 1 -- ds50010--------
    rs1931544781,2
    --72726386(+) GAATCC/TGGGAG 1 -- ds50010--------
    rs356219391,2
    C--72726465(+) AAAAA-/AGACTC 1 -- ds50011Minor allele frequency- A:0.00NA 2
    rs1483327021,2
    --72726732(+) AAATAC/TACCCT 1 -- ut310--------
    rs1475155961,2
    C--72727111(+) GAGTTC/AGCCCT 2 /E /* stg11Minor allele frequency- A:0.00NA 3518
    rs1112791101,2
    C,F--72727156(+) GTGGCC/TGGCCA 2 S G mis11Minor allele frequency- T:0.00NA 2910

    HapMap Linkage Disequilibrium report for TRIM50 (72726535 - 72742085 bp)

    Structural Variations
         Database of Genomic Variants (DGV) 8 variations for TRIM50:    About this table    
    Variant IDTypeSubtypePubMed ID
    esv2734660CNV Deletion23290073
    nsv831027CNV Loss17160897
    esv34349CNV Gain17911159
    dgv7324n71CNV Gain21882294
    nsv888362CNV Gain21882294
    nsv520573CNV Gain+Loss19592680
    dgv2095e1CNV Complex17122850
    dgv2099e1CNV Complex17122850

    Site Specific Mutation Identification with PCR Assays
    Search QIAGEN SeqTarget long-range PCR primers for resequencing TRIM50
    DNA2.0 Custom Variant and Variant Library Synthesis for TRIM50

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    TryGeneCards Plus
    OMIM gene information: 612548    OMIM disorders: --

    1 disease from the University of Copenhagen DISEASES database for TRIM50:
    Williams-Beuren syndrome

    Find genes that share disorders with TRIM50           About GenesLikeMe


    Export disorders for TRIM50 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    TryGeneCards Plus

    PubMed articles for TRIM50 gene integrated from 10 sources:
    (articles sorted by number of sources associating them with TRIM50)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Williams-Beuren syndrome TRIM50 encodes an E3 ubiquitin ligase. (PubMed id 18398435)1, 2 Micale L.... Reymond A. (Eur. J. Hum. Genet. 2008)
    2. The DNA sequence of human chromosome 7. (PubMed id 12853948)1, 2 Hillier L.W.... Wilson R.K. (Nature 2003)
    3. The E3-ubiquitin ligase TRIM50 interacts with HDAC6 and p62, and promotes the sequestration and clearance of ubiquitinated proteins into the aggresome. (PubMed id 22792322)1 Fusco C....Merla G. (PLoS ONE 2012)
    4. Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients. (PubMed id 22610502)1 Kennedy R.B....Poland G.A. (Hum. Genet. 2012)
    5. Functional interactions between ubiquitin E2 enzymes and TRIM proteins. (PubMed id 21143188)1 Napolitano L.M....Meroni G. (Biochem. J. 2011)
    6. Toward a confocal subcellular atlas of the human proteome. (PubMed id 18029348)1 Barbe L....Andersson-Svahn H. (amp 2008)
    7. Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. (PubMed id 16344560)1 Kimura K.... Sugano S. (Genome Res. 2006)
    8. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1 Ota T.... Sugano S. (Nat. Genet. 2004)
    9. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. (PubMed id 12477932)1 Strausberg R.L....Marra M.A. (Proc. Natl. Acad. Sci. U.S.A. 2002)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section

    TryGeneCards Plus
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section

    TryGeneCards Plus
    Entrez Gene: 135892 HGNC: 19017 AceView: TRIM50A Ensembl:ENSG00000146755 euGenes: HUgn135892
    ECgene: TRIM50 H-InvDB: TRIM50

    (According to HUGE)
    About This Section

    TryGeneCards Plus
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL, and/or others, e.g. Wikipedia and GeneReviews, via UniProtKB/Swiss-Prot)
    About This Section

    TryGeneCards Plus
    NameDescription
    PharmGKB entry for TRIM50 Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section

    TryGeneCards Plus
    Patent Information for TRIM50 gene:
    Search GeneIP for patents involving TRIM50

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, eBioscience, and/or others, Gene Editing from DNA2.0. Clones from OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Addgene, Cell lines from GenScript, and ESI BIO, Flow cytometery from eBioscience, PCR Arrays from QIAGEN, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, Enzo Life Sciences, and/or ApexBio, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

    TryGeneCards Plus

     
     EMD Millipore genomic analysis products

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Enzyme Activity Assays/Reagents  
     Browse ELISpot/FluoroSpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Luminex Assays  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Recombinant/Natural Proteins   Browse Stem Cell Products  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     Browse OriGene Antibodies   OriGene RNAi products in human, mouse, rat for TRIM50  
     Browse OriGene qPCR primer pairs and template standards   OriGene Protein Over-expression Lysate for TRIM50  
     OriGene Custom Mass Spec   OriGene clones in human, mouse for TRIM50  
     OriGene qSTAR qPCR primer pairs in human, mouse for TRIM50   Browse OriGene full length recombinant human proteins expressed in human HEK293 cells  
     OriGene ORF clones in mouse, rat for TRIM50   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for TRIM50   OriGene Custom Protein Services for TRIM50  

     
     
     Block miRNA regulation of human, mouse, rat TRIM50 using miScript Target Protectors SeqTarget long-range PCR primers for resequencing TRIM50
     DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat TRIM50 Predesigned siRNA for gene silencing in human, mouse, rat TRIM50
     QuantiFast Probe-based Assays in human, mouse, rat TRIM50 QuantiTect SYBR Green Assays in human, mouse, rat TRIM50
     Custom PCR Arrays for TRIM50 Search Chromatin IP Primers for TRIM50
     Pre-validated RT2 qPCR Primer Assay in human, mouse, rat TRIM50  Search GeneGlobe Interaction Network for TRIM50
     Regulatory tfbs in TRIM50 promoter
     GenScript Custom Purified and Recombinant Proteins Services for TRIM50 GenScript cDNA clones with any tag delivered in your preferred vector for TRIM50
     GenScript Custom Assay Services for TRIM50 GenScript Custom overexpressing Cell Line Services for TRIM50
     CloneReady with Over 120,000 Genes  Gene Synthesis: Any Gene in Any Vector
     Vector-based siRNA and miRNA, Ready for Transfection Gene Mutant Library, Variants up to 10^11
     Plasmid Preparation Custom Peptide Services
     Search for Antibodies & Assays

     Search Tocris compounds for TRIM50 (TRI50)
     Browse Sino Biological Proteins
     Browse Sino Biological Cell Lysates
     Browse Sino Biological cDNA Clones
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies

     Novus Tissue Slides
     TRIM50 antibodies
     Antibodies for TRIM50
     See all of Abcam's Antibodies, Kits and Proteins for TRIM50
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins
     Proteins for TRIM50
     Antibodies for TRIM50
     ELISAs for TRIM50
     CLIAs for TRIM50



     Browse ESI BIO Cell Lines and PureStem Progenitors for TRIM50
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIM50
     SwitchGear 3'UTR luciferase reporter plasmids for TRIM50
     SwitchGear Promoter luciferase reporter plasmids for TRIM50
     Search ThermoFisher Antibodies for TRIM50
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat TRIM50
     inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for TRIM50
     inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for TRIM50
     LSBio Antibodies in human, mouse, rat for TRIM50
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
     Browse compounds at ApexBio
     Search Addgene for plasmids for TRIM50
      Search eBioscience for proteins for TRIM50
      Search eBioscience for elisas for TRIM50
      eBioscience FlowRNA Probe Sets
           
    GeneCards Homepage - Last full update: 7 May 2014 - Incrementals: 9 May 2014 , 2 Jun 2014 , 26 Jun 2014 , 30 Jun 2014 , 21 Aug 2014 , 8 Sep 2014

    View Random Gene

    Category
    (GIFtS: )
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      TRIM50 gene at Home site.
    Version: 3.12.224 13 Oct 2014
    hostname: 356977-web1.xennexinc.com index build: 128 solr: 1.4