Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

TRIM50 Gene

protein-coding   GIFtS: 47
GCID: GC07M072726

Tripartite Motif Containing 50

(Previous names: tripartite motif-containing 50A, tripartite motif-containing...)
(Previous symbol: TRIM50A)
  See related diseases
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

Aliases
Tripartite Motif Containing 501 2     Tripartite Motif-Containing 501
TRIM50A1 2 3 5     E3 Ubiquitin-Protein Ligase TRIM502
Tripartite Motif-Containing 50A1 2     EC 6.3.2.-3
Tripartite Motif-Containing Protein 502 3     EC 6.3.28

External Ids:    HGNC: 190171   Entrez Gene: 1358922   Ensembl: ENSG000001467557   OMIM: 6125485   UniProtKB: Q86XT43   

Export aliases for TRIM50 gene to outside databases

Previous GC identifers: GC07M072124 GC07M072364 GC07M068608


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

GeneCards Summary for TRIM50 Gene: 
TRIM50 (tripartite motif containing 50) is a protein-coding gene. Diseases associated with TRIM50 include williams-beuren syndrome, and smallpox. GO annotations related to this gene include zinc ion binding and ligase activity. An important paralog of this gene is TRIM31.

UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4
Function: E3 ubiquitin-protein ligase




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 73), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000007.13  NC_018918.2  NT_007933.15  NT_079593.2  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the TRIM50 gene promoter:
         STAT1   STAT4   STAT1beta   STAT6   STAT5A   Tal-1beta   STAT1alpha   STAT2   STAT3   ITF-2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): TRIM50 promoter sequence
   Search SABiosciences Chromatin IP Primers for TRIM50

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat TRIM50


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 7q11.23   Ensembl cytogenetic band:  7q11.23   HGNC cytogenetic band: 7q11.23

TRIM50 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
TRIM50 gene location

GeneLoc information about chromosome 7         GeneLoc Exon Structure

GeneLoc location for GC07M072726:  view genomic region     (about GC identifiers)

Start:
72,726,535 bp from pter      End:
72,742,085 bp from pter
Size:
15,551 bases      Orientation:
minus strand

1 alternative location:
Chr7-,CRA_TCAG 72,059,607-72,075,157     

(According to UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MAXQB RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Ontologies according to Gene Ontology Consortium 01 Oct 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4 (See protein sequence)
Recommended Name: E3 ubiquitin-protein ligase TRIM50  
Size: 487 amino acids; 54774 Da
Subunit: Can form dimers and trimers. Interacts with several E2 ubiquitin-conjugating enzymes, including UBE2L6,
UBE2E1, UBE2E3. No interaction with UBE2H
Subcellular location: Cytoplasm
Secondary accessions: Q86XT3
Alternative splicing: 2 isoforms:  Q86XT4-1   Q86XT4-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for TRIM50: NX_Q86XT4

Explore proteomics data for TRIM50 at MOPED 

Post-translational modifications:

  • UniProtKB: Auto-ubiquitinated
  • View modification sites using PhosphoSitePlus
  • View neXtProt modification sites for NX_Q86XT4

  • 2 DME Specific Peptides for TRIM50 (Q86XT4)
     YLHYEQGELTFFDADRPDDLR  LYTFQADFQGKLYPILDTCWHERGSNSLPMVLP 

    TRIM50 Protein expression data from MOPED1, PaxDb2 and MAXQB3 :    About this image 

    TRIM50 Protein Expression
    REFSEQ proteins (3 alternative transcripts): 
    NP_001268379.1  NP_001268380.1  NP_835226.2  

    ENSEMBL proteins: 
     ENSP00000327994   ENSP00000413875  

    Human Recombinant Protein Products for TRIM50: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate for TRIM50
    OriGene Custom MassSpec 
    OriGene Custom Protein Services for TRIM50
    GenScript Custom Purified and Recombinant Proteins Services for TRIM50
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates 
    Browse ProSpec Recombinant Proteins
    Cloud-Clone Corp. Proteins for TRIM50 

    Gene Ontology (GO): 3 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005622intracellular ----
    GO:0005737cytoplasm IEA--
    GO:0043231intracellular membrane-bounded organelle IDA--

    TRIM50 for ontologies           About GeneDecksing



    TRIM50 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for TRIM50
    GenScript Custom Superior Antibodies Services for TRIM50
    Novus Biologicals TRIM50 Antibody
    Abcam antibodies for TRIM50
    Cloud-Clone Corp. Antibodies for TRIM50 
    Search ThermoFisher Antibodies for TRIM50
    LSBio Antibodies in human, mouse, rat for TRIM50 

    Assay Products for TRIM50: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for TRIM50
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for TRIM50
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for TRIM50 
    Cloud-Clone Corp. CLIAs for TRIM50


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section
    HGNC Gene Families: 
    TRIM: Tripartite motif containing / Tripartite motif containing
    RNF: RING-type (C3HC4) zinc fingers

    5/9 InterPro protein domains (see all 9):
     IPR006574 PRY
     IPR017907 Znf_RING_CS
     IPR001841 Znf_RING
     IPR001870 B30.2/SPRY
     IPR003877 SPRY_rcpt

    Graphical View of Domain Structure for InterPro Entry Q86XT4

    ProtoNet protein and cluster: Q86XT4

    4 Blocks protein domains:
    IPB000315 B-box zinc finger signature
    IPB001841 Zn-finger
    IPB003879 Butyrophylin C-terminal DUF signature
    IPB006574 SPRY-associated domain


    UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4
    Similarity: Belongs to the TRIM/RBCC family
    Similarity: Contains 1 B box-type zinc finger
    Similarity: Contains 1 B30.2/SPRY domain
    Similarity: Contains 1 RING-type zinc finger


    TRIM50 for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase, shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Sirion Biotech, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, Vector BioLabs, and Sirion Biotech, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene.)
    About This Section

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: TRI50_HUMAN, Q86XT4
    Function: E3 ubiquitin-protein ligase

         Enzyme Numbers (IUBMB): EC 6.3.2.-1 EC 6.3.22

         Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005515protein binding ----
    GO:0008270zinc ion binding IEA--
    GO:0016874ligase activity IEA--
    GO:0046872metal ion binding ----
         
    TRIM50 for ontologies           About GeneDecksing


    Phenotypes:
         2 GenomeRNAi human phenotypes for TRIM50:
     G0/1 arrest  Increased S DNA content 

         2 MGI mutant phenotypes (inferred from 2 alleles(MGI details for Trim50):
     digestive/alimentary  no phenotypic analysis 

    TRIM50 for phenotypes           About GeneDecksing

    Animal Models:
         MGI mouse knock-out Trim50tm1Hta for TRIM50

       inGenious Targeting Laboratory - Custom generated mouse model solutions for TRIM50 
       inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for TRIM50

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for TRIM50 
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for TRIM50 

    miRNA
    Products:
        
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat TRIM50
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate TRIM50
    SwitchGear 3'UTR luciferase reporter plasmidTRIM50 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for TRIM50
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIM50

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for TRIM50
    Sirion Biotech Customized adenovirus for overexpression of TRIM50

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene clones in human, mouse for TRIM50 (see all 7)
    OriGene ORF clones in mouse, rat for TRIM50
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: TRIM50 (NM_178125)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIM50
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat TRIM50
    Sirion Biotech Customized lentivirus for stable overexpression of TRIM50 
                         Customized lentivirus expression plasmids for stable overexpression of TRIM50 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for TRIM50
    Search LifeMap BioReagents cell lines for TRIM50
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIM50


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene).
    About This Section



    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for TRIM50

    STRING Interaction Network Preview (showing 5 interactants - click image to see 8)

    5/8 Interacting proteins for TRIM50 (ENSP000003279944) via UniProtKB, MINT, STRING, and/or I2D (see all 8)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    UBE2D1ENSP000003630194STRING: ENSP00000363019
    UBE2D2ENSP000003817174STRING: ENSP00000381717
    UBE2D3ENSP000003497224STRING: ENSP00000349722
    UBE2D4ENSP000002224024STRING: ENSP00000222402
    UBE2E1ENSP000003037094STRING: ENSP00000303709
    About this table

    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section
    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for TRIM50 (TRI50)

    Search CenterWatch for drugs/clinical trials and news about TRIM50 / TRI50

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Sirion Biotech, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for TRIM50 gene (3 alternative transcripts): 
    NM_001281450.1  NM_001281451.1  NM_178125.3  

    Unigene Cluster for TRIM50:

    Tripartite motif containing 50
    Hs.647053  [show with all ESTs]
    Unigene Representative Sequence: AY081948
    4 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000333149(uc010lbd.1 uc003txy.1 uc003txz.1) ENST00000453152
    ENST00000488217 ENST00000493498
    miRNA
    Products:
         
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat TRIM50
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate TRIM50
    SwitchGear 3'UTR luciferase reporter plasmidTRIM50 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for TRIM50
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIM50
    Clone
    Products:
         
    OriGene clones in human, mouse for TRIM50 (see all 7)
    OriGene ORF clones in mouse, rat for TRIM50
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: TRIM50 (NM_178125)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIM50
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat TRIM50
    Sirion Biotech Customized lentivirus for stable overexpression of TRIM50 
                         Customized lentivirus expression plasmids for stable overexpression of TRIM50 
    Primer
    Products:
        
    OriGene qSTAR qPCR primer pairs in human, mouse for TRIM50
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat TRIM50
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIM50
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIM50

    Additional mRNA sequence: 

    AK057366.1 AK292074.1 AY081948.1 AY081949.1 BC112152.1 BC112154.1 BC143787.1 

    8 DOTS entries:

    DT.40233928  DT.443249  DT.92417013  DT.40131438  DT.75101643  DT.75115935  DT.100736906  DT.440570 

    24/31 AceView cDNA sequences (see all 31):

    AI928331 AI310113 BE466482 NM_178125 AY081948 AW058675 AI675279 AW614271 
    AI916523 AI306456 AY081949 BG413566 AI763201 BG413545 AI768759 AI027904 
    AA844922 AI307283 AI949449 AK057366 AI208986 AA621610 AW299621 AW296619 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TRIM50 expression in normal human tissues (normalized intensities)      TRIM50 embryonic expression: see
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: TATACCTTTT
    TRIM50 Expression
    About this image


    TRIM50 expression in embryonic tissues and stem cells    About this table
    Data from LifeMap, the Embryonic Development and Stem Cells Database 
     5/2 selected tissues (see all 2) fully expand
     
     Stomach (Gastrointestinal Tract)
             stomach cardiac   
     
     Pancreas (Endocrine System)
             Posterior foregut-like cells ( A scalable, suspension protocol for derivation of...

    See TRIM50 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for TRIM50

    SOURCE GeneReport for Unigene cluster: Hs.647053
        SABiosciences Custom PCR Arrays for TRIM50
    Primer
    Products:
    OriGene qSTAR qPCR primer pairs in human, mouse for TRIM50
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat TRIM50
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIM50
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIM50
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIM50

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of chordates.

    Orthologs for TRIM50 gene from 2/6 species (see all 6)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Trim501 , 5 tripartite motif-containing 501, 5 84.31(n)1
    89.08(a)1
      5 (75.15 cM)5
    2150611  NM_178240.21  NP_839971.11 
     1353532955 
    chicken
    (Gallus gallus)
    Aves TRIM501 tripartite motif containing 50 68.66(n)
    61.32(a)
      417461  XM_415709.2  XP_415709.2 


    ENSEMBL Gene Tree for TRIM50 (if available)
    TreeFam Gene Tree for TRIM50 (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for TRIM50 gene
    TRIM312  TRIM522  TRIM732  TRIM612  TRIM352  TRIM692  TRIM742  TRIM622  
    TRIM412  TRIM722  
    11 SIMAP similar genes for TRIM50 using alignment to 3 protein entries:     TRI50_HUMAN (see all proteins):
    TRIM73    TRIM74    MEFV    TRIM39    BRCA1    TRIM5
    TRIM72    BT3.3    BTNL9    TRIM61    TRIM62

    TRIM50 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/328 SNPs in TRIM50 are shown (see all 328)    About this table     
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 7 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1456771831,2
    Cuntested172730580(+) TTCCGA/C/GAAGAG 2 F syn11NA 4550
    rs1491498271,2
    --72726061(+) CTCAGA/GAGGCT 1 -- ds50010--------
    rs1855337321,2
    --72726143(+) CCTGGC/GTGACA 1 -- ds50010--------
    rs1432832771,2
    --72726200(+) GCTCAC/TGCCTG 1 -- ds50010--------
    rs1904049561,2
    --72726283(+) CACAGC/TGAAAC 1 -- ds50010--------
    rs1931544781,2
    --72726386(+) GAATCC/TGGGAG 1 -- ds50010--------
    rs356219391,2
    C--72726465(+) AAAAA-/AGACTC 1 -- ds50011Minor allele frequency- A:0.00NA 2
    rs1483327021,2
    --72726732(+) AAATAC/TACCCT 1 -- ut310--------
    rs1475155961,2
    C--72727111(+) GAGTTC/AGCCCT 2 /E /* stg11Minor allele frequency- A:0.00NA 3518
    rs1112791101,2
    C,F--72727156(+) GTGGCC/TGGCCA 2 S G mis11Minor allele frequency- T:0.00NA 2910

    HapMap Linkage Disequilibrium report for TRIM50 (72726535 - 72742085 bp)

    Structural Variations
         Database of Genomic Variants (DGV) 8 variations for TRIM50:    About this table     
    Variant IDTypeSubtypePubMed ID
    esv2734660CNV Deletion23290073
    nsv831027CNV Loss17160897
    esv34349CNV Gain17911159
    dgv7324n71CNV Gain21882294
    nsv888362CNV Gain21882294
    nsv520573CNV Gain+Loss19592680
    dgv2095e1CNV Complex17122850
    dgv2099e1CNV Complex17122850

    SABiosciences Cancer Mutation PCR Assays
    Search QIAGEN SeqTarget long-range PCR primers for resequencing TRIM50
    DNA2.0 Custom Variant and Variant Library Synthesis for TRIM50

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section
    OMIM gene information: 612548    OMIM disorders: --

    2 diseases for TRIM50:    About MalaCards
    williams-beuren syndrome    smallpox

    1 disease from the University of Copenhagen DISEASES database for TRIM50:
    Williams-Beuren syndrome

    TRIM50 for disorders           About GeneDecksing


    Export disorders for TRIM50 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for TRIM50 gene integrated from 9 sources:
    (articles sorted by number of sources associating them with TRIM50)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Williams-Beuren syndrome TRIM50 encodes an E3 ubiquitin ligase. (PubMed id 18398435)1, 2 Micale L....Reymond A. (2008)
    2. The DNA sequence of human chromosome 7. (PubMed id 12853948)1, 2 Hillier L.W.... Wilson R.K. (2003)
    3. Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients. (PubMed id 22610502)1 Kennedy R.B....Poland G.A. (2012)
    4. The E3-ubiquitin ligase TRIM50 interacts with HDAC6 an d p62, and promotes the sequestration and clearance of ubiquitinated proteins in to the aggresome. (PubMed id 22792322)1 Fusco C....Merla G. (2012)
    5. Functional interactions between ubiquitin E2 enzymes a nd TRIM proteins. (PubMed id 21143188)1 Napolitano L.M....Meroni G. (2011)
    6. Toward a confocal subcellular atlas of the human proteome. (PubMed id 18029348)1 Barbe L....Andersson-Svahn H. (2008)
    7. Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. (PubMed id 16344560)1 Kimura K.... Sugano S. (2006)
    8. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1 Ota T.... Sugano S. (2004)
    9. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. (PubMed id 12477932)1 Strausberg R.L....Marra M.A. (2002)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 135892 HGNC: 19017 AceView: TRIM50A Ensembl:ENSG00000146755 euGenes: HUgn135892
    ECgene: TRIM50 H-InvDB: TRIM50

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for TRIM50 Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for TRIM50 gene:
    Search GeneIP for patents involving TRIM50

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0 and Sirion Biotech, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Sirion Biotech, Cell lines from GenScript, and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Protease Activity Assays and Reagents   Browse Recombinant/Natural Proteins  
     Browse Stem Cell Products   Browse Tocris Biochemicals & Compounds  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     Browse OriGene Antibodies   OriGene RNAi products in human, mouse, rat for TRIM50  
     Browse OriGene qPCR primer pairs and template standards   OriGene Protein Over-expression Lysate for TRIM50  
     OriGene Custom Mass Spec   OriGene clones in human, mouse for TRIM50  
     OriGene qSTAR qPCR primer pairs in human, mouse for TRIM50   Browse OriGene full length recombinant human proteins expressed in human HEK293 cells  
     OriGene ORF clones in mouse, rat for TRIM50   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for TRIM50   OriGene Custom Protein Services for TRIM50  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat TRIM50
     QIAGEN SeqTarget long-range PCR primers for resequencing TRIM50
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat TRIM50
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIM50
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIM50
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIM50
     GenScript Custom Purified and Recombinant Proteins Services for TRIM50 GenScript cDNA clones with any tag delivered in your preferred vector for TRIM50
     GenScript Custom Assay Services for TRIM50 GenScript Custom Superior Antibodies Services for TRIM50
     GenScript Custom overexpressing Cell Line Services for TRIM50 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in TRIM50 promoter
     Search Chromatin IP Primers for TRIM50
     RT2 qPCR Primer Assay in human, mouse, rat TRIM50
     Search GNC Networks for TRIM50
     SABiosciences Custom PCR Arrays for TRIM50
     Search Tocris compounds for TRIM50 (TRI50)
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological Cell Lysates
     Browse Sino Biological cDNA Clones
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     TRIM50 antibodies
     Antibodies for TRIM50
     See all of Abcam's Antibodies, Kits and Proteins for TRIM50
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     Proteins for TRIM50
     Antibodies for TRIM50
     ELISAs for TRIM50
     CLIAs for TRIM50
     Search LifeMap BioReagents cell lines for TRIM50
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIM50
     SwitchGear 3'UTR luciferase reporter plasmids for TRIM50
     SwitchGear Promoter luciferase reporter plasmids for TRIM50
     Search ThermoFisher Antibodies for TRIM50
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat TRIM50
     inGenious Targeting Laboratory - Custom generated mouse model solutions for TRIM50
     inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for TRIM50
    Customized:
     lentivirus for stable overexpression of TRIM50
     lentivirus expression plasmids for stable overexpression of TRIM50
     adenovirus for overexpression of TRIM50
     LSBio Antibodies in human, mouse, rat for TRIM50
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
           
    GeneCards Homepage - Last full update: 23 Oct 2013 - Incrementals: 4 Nov 2013 , 7 Nov 2013 , 23 Jan 2014

    View Random Gene

    Category
    (GIFtS: 73)
    transforming growth factor, beta 1
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      TRIM50 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 106 solr: 1.4