Home
GeneCards Guide
Suite
- MalaCards
- GeneALaCart
- GeneDecks
- GeneIP
- GeneLoc
Terms and Conditions
- Terms of Use
- 3rd Party Notice
About Us
User Feedback
Mirror sites

Set Analyses:

Generates a file of GeneCards annotations for your list of genes

Advanced Search

Search By

Section (entire)

for

All GeneCards Within gene subset (to enable gene prioritization):
or upload a file of gene symbols

Category Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21

GIFtS
-

TRIM50 Gene

protein-coding GIFtS: 48
GCID: GC07M072726

tripartite motif containing 50

(Previous names: tripartite motif-containing 50A, tripartite motif-containing...)
(Previous symbol: TRIM50A)

Explore 1 disease affiliated with
TRIM50 via

MalaCards

our new
Human Malady Compendium

(According to ¹HGNC, ²Entrez Gene,
³UniProtKB/Swiss-Prot, ⁴UniProtKB/TrEMBL, ⁵OMIM, ⁶GeneLoc, ⁷Ensembl, ⁸DME, ⁹miRBase, and/or ¹⁰fRNAdb)
About This Section

Aliases
Tripartite Motif Containing 50¹ ²		E3 Ubiquitin Ligase²
TRIM50A¹ ² ³ ⁵		E3 Ubiquitin-Protein Ligase TRIM50²
Tripartite Motif-Containing 50¹ ²		Tripartite Motif Protein 50²
Tripartite Motif-Containing 50A¹ ²		EC 6.3.2.-³
Tripartite Motif-Containing Protein 50² ³		EC 6.3.2⁸
FLJ32804¹

External Ids:	HGNC: 19017¹	Entrez Gene: 135892²	Ensembl: ENSG00000146755⁷	OMIM: 612548⁵	UniProtKB: Q86XT4³

Export aliases for TRIM50 gene to outside databases

Previous GC identifers: GC07M072124 GC07M072364 GC07M068608

(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4

Function: E3 ubiquitin-protein ligase

(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section

RefSeq DNA sequence:

NC_000007.13 NC_018918.1 NT_007933.15 NT_079593.2

Regulatory elements:

SABiosciences Regulatory transcription factor binding sites in the TRIM50 gene promoter:
STAT1 STAT4 STAT1beta STAT6 STAT5A Tal-1beta STAT1alpha STAT2 STAT3 ITF-2
Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 2): TRIM50 promoter sequence

Search SABiosciences Chromatin IP Primers for TRIM50

Epigenetics:

QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat TRIM50

Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 7q11.23 Ensembl cytogenetic band: 7q11.23 HGNC cytogenetic band: 7q11.23

TRIM50 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
TRIM50 gene location

GeneLoc information about chromosome 7 GeneLoc Exon Structure

GeneLoc location for GC07M072726: view genomic region (about GC identifiers)

Start:	72,726,535 bp from pter	End:	72,742,085 bp from pter
Size:	15,551 bases	Orientation:	minus strand

1 alternative location:

Chr7-,CRA_TCAG 72,059,607-72,075,157

(According to ¹UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to ²PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4 (See protein sequence)

Recommended Name: E3 ubiquitin-protein ligase TRIM50

Size: 487 amino acids; 54774 Da

Subunit: Can form dimers and trimers. Interacts with several E2 ubiquitin-conjugating enzymes, including UBE2L6,

UBE2E1, UBE2E3. No interaction with UBE2H

Subcellular location: Cytoplasm

Secondary accessions: Q86XT3

Alternative splicing: 2 isoforms: Q86XT4-1 Q86XT4-2 (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for TRIM50: NX_Q86XT4

Post-translational modifications:

Auto-ubiquitinated¹

View modification sites using PhosphoSitePlus²

View neXtProt modification sites for NX_Q86XT4

2 DME Specific Peptides for TRIM50 (Q86XT4)

YLHYEQGELTFFDADRPDDLR

LYTFQADFQGKLYPILDTCWHERGSNSLPMVLP

TRIM50 Protein expression data from MOPED and PaxDb: About this image

REFSEQ proteins: NP_835226.1

ENSEMBL proteins:

ENSP00000327994 ENSP00000413875

Human Recombinant Protein Products:

	Browse Purified and Recombinant Proteins at EMD Millipore
	Browse R&D Systems for human recombinant proteins
	Browse recombinant and purified proteins available from Enzo Life Sciences
	Browse OriGene full length recombinant human proteins expressed in human HEK293 cells OriGene Protein Over-expression Lysate: TRIM50 OriGene Custom Protein Services for TRIM50
	GenScript Custom Purified and Recombinant Proteins Services for TRIM50
	Browse Sino Biological Recombinant Proteins
	Browse ProSpec Recombinant Proteins
	Uscn Proteins for TRIM50

Gene Ontology (GO): 2 cellular component terms (GO ID links to tree view): About this table

GO ID	Qualified GO term	Evidence	PubMed IDs
GO:0005737	cytoplasm	IEA	--
GO:0043231	intracellular membrane-bounded organelle	IDA	--

TRIM50 for ontologies About GeneDecksing

TRIM50 Antibody Products:

	Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
	Browse R&D Systems for Antibodies
	Browse OriGene Antibodies OriGene Custom Antibody Services for TRIM50
	GenScript Custom Superior Antibodies Services for TRIM50
	Novus Biologicals TRIM50 Antibody
	Search for Antibodies for TRIM50 at Abcam
	Uscn Antibodies for TRIM50
	Search ThermoFisher Antibodies for TRIM50

Assay Products for TRIM50:

	Browse Kits and Assays available from EMD Millipore
	OriGene Custom Immunoassay Development Browse OriGene Fluorogenic Cell Assay Kits
	Browse R&D Systems for biochemical assays
	GenScript Custom Assay Services for TRIM50
	Browse Enzo Life Sciences for kits & assays
	Uscn ELISAs and CLIAs for TRIM50

(According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
About This Section

TRIM50 for domains About GeneDecksing

5/9 InterPro domains/families (see all 9):

IPR006574 PRY

IPR017907 Znf_RING_CS

IPR001841 Znf_RING

IPR001870 B30.2/SPRY

IPR003877 SPRY_rcpt

Graphical View of Domain Structure for InterPro Entry Q86XT4

ProtoNet protein and cluster: Q86XT4

4 Blocks protein families:

IPB000315 B-box zinc finger signature

IPB001841 Zn-finger

IPB003879 Butyrophylin C-terminal DUF signature

IPB006574 SPRY-associated domain

UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4

Similarity: Belongs to the TRIM/RBCC family

Similarity: Contains 1 B box-type zinc finger

Similarity: Contains 1 B30.2/SPRY domain

Similarity: Contains 1 RING-type zinc finger

(According to ¹UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or ²DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
About This Section

Function Summary:

UniProtKB/Swiss-Prot: TRI50_HUMAN, Q86XT4

Function: E3 ubiquitin-protein ligase

Enzyme Numbers (IUBMB): EC 6.3.2.-¹ EC 6.3.2²

miRNA Products:		OriGene 3'-UTR Clone: TRIM50 Browse MicroRNA Expression Plasmids
		QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat TRIM50
		Search QIAGEN for miScript miRNA Assays for microRNAs that regulate TRIM50
		SwitchGear 3'UTR luciferase reporter plasmid: TRIM50 3' UTR sequence

Inhib. RNA Products:		Browse for Gene Knock-down Tools from EMD Millipore
		OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for TRIM50 (see all 7) OriGene shRNA RFP: TRIM50 OriGene siRNA: TRIM50
		QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIM50

Gene Editing
Products:

DNA2.0 Custom Protein Engineering Service for TRIM50

Clone Products:		Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
		OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for TRIM50 (see all 3) OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for TRIM50 OriGene custom cloning services � gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
		GenScript: all cDNA clones in your preferred vector: TRIM50 (NM_178125)
		Browse Sino Biological Human cDNA Clones
		DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIM50
		Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat TRIM50

Cell Line Products:		GenScript Custom overexpressing Cell Line Services for TRIM50
		Search LifeMap BioReagents cell lines for TRIM50

In Situ Assay
Products:

Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIM50

Gene Ontology (GO): 2 molecular function terms (GO ID links to tree view): About this table

GO ID	Qualified GO term	Evidence	PubMed IDs
GO:0008270	zinc ion binding	IEA	--
GO:0016874	ligase activity	IEA	--

TRIM50 for ontologies About GeneDecksing

2 GenomeRNAi human phenotypes for TRIM50:

G0/1 arrest

Increased S DNA content

Animal Models:
Mouse knock-out Trim50^tm1Hta for TRIM50
2 MGI mutant phenotypes (inferred from 2 alleles) (MGI details for Trim50):

digestive/alimentary

no phenotypic analysis

TRIM50 for phenotypes About GeneDecksing

(Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to ¹UniProtKB, ²MINT, ³I2D, and/or ⁴STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
About This Section

Interactions:

Search SABiosciences Gene Network Central^TM Interacting Genes and Proteins Networks for TRIM50

STRING Interaction Network Preview (showing 5 interactants - click image to see 8)

5/8 Interacting proteins for TRIM50 (ENSP00000327994⁴) via UniProtKB, MINT, STRING, and/or I2D (see all 8)

Interactant		Interaction Details
GeneCard	External ID(s)	Interaction Details
UBE2D1	ENSP00000363019⁴	STRING: ENSP00000363019
UBE2D2	ENSP00000381717⁴	STRING: ENSP00000381717
UBE2D3	ENSP00000349722⁴	STRING: ENSP00000349722
UBE2D4	ENSP00000222402⁴	STRING: ENSP00000222402
UBE2E1	ENSP00000303709⁴	STRING: ENSP00000303709

About this table

(Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
About This Section

Browse Small Molecules at EMD Millipore

Browse drugs & compounds from Enzo Life Sciences

Browse Tocris compounds for TRIM50
Search CenterWatch for drugs/clinical trials and news about TRIM50 / TRI50

(Secondary structures according to fRNAdb,
GenBank/EMBL/DDBJ Accessions according to
Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
RefSeq according to Entrez Gene,
DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
RNAi Products from EMD Millipore,
siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
About This Section

REFSEQ mRNAs for TRIM50 gene:

NM_178125.2

Unigene Cluster for TRIM50:

Tripartite motif containing 50

Hs.647053 [show with all ESTs]

Unigene Representative Sequence: AY081948

4 Ensembl transcripts including schematic representations, and UCSC links where relevant:

ENST00000333149(uc010lbd.1 uc003txy.1 uc003txz.1) ENST00000453152

ENST00000488217 ENST00000493498

miRNA Products:		OriGene 3'-UTR Clone: TRIM50 Browse OriGene MicroRNA Expression Plasmids
		QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat TRIM50
		Search QIAGEN for miScript miRNA Assays for microRNAs that regulate TRIM50
		SwitchGear 3'UTR luciferase reporter plasmid: TRIM50 3' UTR sequence

Inhib. RNA Products:		Browse for Gene Knock-down Tools from EMD Millipore
		OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for TRIM50 (see all 7) OriGene shRNA RFP: TRIM50 OriGene siRNA: TRIM50
		QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIM50

Clone Products:		OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for TRIM50 (see all 3) OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for TRIM50 OriGene custom cloning services � gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
		GenScript: all cDNA clones in your preferred vector: TRIM50 (NM_178125)
		DNA2.0 Custom Codon Optimized Gene Synthesis Service for TRIM50
		Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat TRIM50

Primer Products:		OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for TRIM50 Browse OriGene validated miRNA SYBR primer pairs
		SABiosciences RT² qPCR Primer Assay in human, mouse, rat TRIM50
		QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIM50
		QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIM50

Additional cDNA sequence:

AK057366.1 AK292074.1 AY081948.1 AY081949.1 BC112152.1 BC112154.1 BC143787.1

8 DOTS entries:

DT.40233928 DT.443249 DT.92417013 DT.40131438 DT.75101643 DT.75115935 DT.100736906 DT.440570

24/31 AceView cDNA sequences (see all 31):

AW614271 AI310113 BE466482 AY081948 AW058675 AI916523 AI928331 AI675279

AY081949 AI306456 NM_178125 AA621610 AI949449 AI763201 AA844922 AW299621

AI027904 AW296619 BX100375 AI208986 BG413566 AI768759 AW024178 BG413545

GeneLoc Exon Structure

(RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
About This Section

TRIM50 expression in normal human tissues (normalized intensities)
See probesets specificity/sensitivity at GeneAnnot
About this imageBioGPS
CGAP TAG: TATACCTTTT

About this image

TRIM50 expression in embryonic tissues and stem cells

Expression by the Database of Embryonic development, Stem cell research, and Regenerative medicine About this table

Stem Cell Differentiation: 1 LifeMap Cell

Name

Category

Posterior foregut-like cells (A scalable, suspensi...)

Expression:

Positive

Negative

Selective marker

Experimental details:

Curated

Microarrays

In-situ hybridization

See TRIM50 Protein Expression from SPIRE MOPED and PaxDB
Genevestigator expression for TRIM50

SOURCE GeneReport for Unigene cluster: Hs.647053

SABiosciences Custom PCR Arrays for TRIM50

Primer Products:		OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for TRIM50 Browse OriGene validated miRNA SYBR primer pairs
		SABiosciences RT² qPCR Primer Assay in human, mouse, rat TRIM50
		QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIM50
		QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIM50

In Situ
Assay Products:

Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIM50

(Orthologs according to ^1,2HomoloGene (²older version, for species not in ¹newer version), ³euGenes, ⁴SGD , ⁵MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or ⁶Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
About This Section

This gene was present in the common ancestor of chordates.

Orthologs for TRIM50 gene from 1/6 species (see all 6) About this table

Organism	Taxonomic classification	Gene	Description	Human Similarity	Orthology Type	Details
chicken (Gallus gallus)	Aves	TRIM50¹	tripartite motif containing 50	68.66(n) 61.32(a)		417461 XM_415709.2 XP_415709.2

ENSEMBL Gene Tree for TRIM50 (if available)
TreeFam Gene Tree for TRIM50 (if available)

(Paralogs according to ¹HomoloGene,
²Ensembl, and ³SIMAP, Pseudogenes according to ⁴Pseudogene.org Build 68)
About This Section

Paralogs for TRIM50 gene

TRIM31² TRIM35² TRIM73² TRIM52² TRIM69² TRIM74² TRIM62² TRIM41²

TRIM72²

13 SIMAP similar genes for TRIM50 using alignment to 3 protein entries: TRI50_HUMAN (see all proteins):

TRIM73 TRIM74 MEFV BRCA1 TRIM5 TRIM39

TRIM72 BT3.3 BTNL9 TRIM61 TRIM62 TRIM27

TRIM69

TRIM50 for paralogs About GeneDecksing

(SNPs/Variants according to the ¹NCBI SNP Database, ²Ensembl, ³PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
About This Section

SNP ID	Valid	Clinical significance	Chr 7 pos	Sequence	#	AA Chg	Type	More	#	Allele freq	Pop	Total sample	More
Genomic Data					Transcription Related Data				Allele Frequencies
				--	--	--		--	--
rs149149827^1,2		--	72726061(+)	`CTCAGA/GAGGCT`	1	--	ds500¹		0	--	--	--	--
rs185533732^1,2		--	72726143(+)	`CCTGGC/GTGACA`	1	--	ds500¹		0	--	--	--	--
rs143283277^1,2		--	72726200(+)	`GCTCAC/TGCCTG`	1	--	ds500¹		0	--	--	--	--
rs190404956^1,2		--	72726283(+)	`CACAGC/TGAAAC`	1	--	ds500¹		0	--	--	--	--
rs193154478^1,2		--	72726386(+)	`GAATCC/TGGGAG`	1	--	ds500¹		0	--	--	--	--
rs35621939^1,2	C	--	72726465(+)	`AAAAA-/AGACTC`	1	--	ds500¹		1		NA	2
rs148332702^1,2		--	72726732(+)	`AAATAC/TACCCT`	1	--	ut3¹		0	--	--	--	--
rs147515596^1,2	C	--	72727111(+)	`GAGTTC/AGCCCT`	2	/E /*	stg¹		1		NA	3518
rs111279110^1,2	C,F	--	72727156(+)	`GTGGCC/TGGCCA`	2	S G	mis¹		1		NA	2910
rs200220785^1,2		--	72727157(+)	`TGGCCA/GGCCAC`	2	A	syn¹		0	--	--	--	--

HapMap Linkage Disequilibrium report for TRIM50 (72726535 - 72742085 bp)
Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
Database of Genomic Variants (DGV): 3 variations for TRIM50
3 CNVs: 2699 3685 8567

SABiosciences Cancer Mutation PCR Assays

Search QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing TRIM50

DNA2.0 Custom Variant and Variant Library Synthesis for TRIM50

(in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
About This Section

TRIM50 for disorders           About GeneDecksing

OMIM gene information: 612548    OMIM disorders: --

1 disease for TRIM50:    About MalaCards

williams-beuren syndrome

1 disease from the University of Copenhagen DISEASES database for TRIM50:

Williams-Beuren syndrome

Export disorders for TRIM50 gene to outside databases

(in PubMed. Associations of this gene to articles via ¹Entrez Gene, ²UniProtKB/Swiss-Prot, ³HGNC, ⁴GAD, ⁵PharmGKB, ⁶HMDB, ⁷DrugBank, ⁸UniProtKB/TrEMBL, ⁹ Novoseek, and/or ¹⁰fRNAdb)
About This Section

PubMed articles for TRIM50 gene integrated from 9 sources:
(articles sorted by number of sources associating them with TRIM50)

Utopia: connect your pdf to the dynamic
world of online information

Williams-Beuren syndrome TRIM50 encodes an E3 ubiquitin ligase. (PubMed id 18398435)^{1, 2} Micale L....Reymond A. (2008)
The DNA sequence of human chromosome 7. (PubMed id 12853948)^{1, 2} Hillier L.W.... Wilson R.K. (2003)
Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients. (PubMed id 22610502)¹ Kennedy R.B....Poland G.A. (2012)
The E3-ubiquitin ligase TRIM50 interacts with HDAC6 an d p62, and promotes the sequestration and clearance of ubiquitinated proteins in to the aggresome. (PubMed id 22792322)¹ Fusco C....Merla G. (2012)
Functional interactions between ubiquitin E2 enzymes a nd TRIM proteins. (PubMed id 21143188)¹ Napolitano L.M....Meroni G. (2011)
Toward a confocal subcellular atlas of the human proteome. (PubMed id 18029348)¹ Barbe L....Andersson-Svahn H. (2008)
Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)¹ Ota T.... Sugano S. (2004)
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. (PubMed id 12477932)¹ Strausberg R.L....Marra M.A. (2002)

(in PubMed, OMIM, and NCBI Bookshelf)
About This Section

		AND	OR
Aliases
Free Text

Query String		PubMed OMIM NCBI Bookshelf
	(Note: In FireFox, select the above section and copy using Ctrl-C)

(According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
About This Section

Entrez Gene: 135892	HGNC: 19017	AceView: TRIM50A	Ensembl:ENSG00000146755	euGenes: HUgn135892
ECgene: TRIM50	H-InvDB: TRIM50

(According to HUGE)
About This Section

(According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
About This Section

Name	Description
PharmGKB entry for TRIM50	Pharmacogenomics, SNPs, Pathways

Intellectual Property for TRIM50 gene
(Patent information from GeneIP, Licensable technologies from WIS Yeda, Salk, Tufts, IP news from LifeMap Sciences, Inc.)

About This Section

Patent Information for TRIM50 gene:
Search GeneIP for patents involving TRIM50

GeneCards and IP:
Japan Patent Office Licenses GeneCards European Patent Office Licenses GeneCards Improving the IP Search

(Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
In Situ Hybridization Assays from
Advanced Cell Diagnostics
About This Section


	EMD Millipore Custom Antibody & Bulk Services
	EMD Millipore Preclinical / Clinical Development Services
	EMD Millipore Immunoassay Services
	EMD Millipore Target Screening & Profiling Services

	Browse Antibodies		Browse Cell Culture Products
	Browse ELISAs		Browse Flow Cytometry Kits
	Browse Primer Pairs		Browse Kinase Activity Assays/Reagents
	Browse ELISpot Kits/Development Modules		Browse TFB/Immunoprecipitation Assays
	Browse Apoptosis Detection Kits/Reagents		Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents
	Browse DNA Damage/Repair Kits/Reagents		Browse Multiplex/Array Assay Kits/Reagents
	Browse Cell Selection/Detection Kits/Reagents		Browse Secondary Antibodies/Controls/Staining Reagents
	Browse Phosphatase Activity Assays/Reagents		Browse Recombinant/Natural Proteins

	Browse OriGene Antibodies		OriGene shRNA RFP for TRIM50
	OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for TRIM50		OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for TRIM50
	OriGene Protein Over-expression Lysate for TRIM50		Browse OriGene Fluorogenic Cell Assay Kits
	OriGene siRNA for TRIM50		OriGene 3'-UTR Clone for TRIM50
	OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for TRIM50		OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for TRIM50
	Browse OriGene GFP tagged cDNA clones in CMV expression vector		Browse OriGene MicroRNA Expression Plasmids
	Browse OriGene basic RS shRNAs		Browse OriGene validated miRNA SYBR primer pairs
	Browse OriGene full length recombinant human proteins expressed in human HEK293 cells		OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
	OriGene Custom Antibody Services for TRIM50		OriGene Custom Protein Services for TRIM50
	OriGene Custom Immunoassay Development

	QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat TRIM50
	Search QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing TRIM50
	QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat TRIM50
	QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat TRIM50
	QIAGEN QuantiFast Probe-based Assays in human, mouse, rat TRIM50
	QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat TRIM50

	GenScript Custom Purified and Recombinant Proteins Services for TRIM50		GenScript cDNA clones with any tag delivered in your preferred vector for TRIM50
	GenScript Custom Assay Services for TRIM50		GenScript Custom Superior Antibodies Services for TRIM50
	GenScript Custom overexpressing Cell Line Services for TRIM50		CloneReady with Over 120,000 Genes
	Gene Synthesis: Any Gene in Any Vector		Vector-based siRNA and miRNA, Ready for Transfection
	Gene Mutant Library, Variants up to 10^11		Plasmid Preparation
	Custom Peptide Services

Search for Antibodies & Assays

	Regulatory tfbs in TRIM50 promoter
	Search Chromatin IP Primers for TRIM50
	RT² qPCR Primer Assay in human, mouse, rat TRIM50
	Search GNC Networks for TRIM50
	SABiosciences Custom PCR Arrays for TRIM50

Search Tocris compounds for TRIM50

	Browse Sino Biological Proteins and Antibodies
	Browse Sino Biological cDNA Clones
	Antibodies/Proteins Production Services
	Rabbit Monoclonal Antibody Platform
	Bulk Purchasing

Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies

	Novus Tissue Slides
	TRIM50 antibodies

	Search for Antibodies for TRIM50 at Abcam
	See all of Abcam's Antibodies, Kits and Proteins for TRIM50
	Custom Antibody / Protein Production Service
	Bulk Purchasing
	Advantages of Rabbit Monoclonal antibodies
	Abcam protocols and scientific support

Browse ProSpec Recombinant Proteins

TRIM50 Proteins, Antibodies, CLIAs, and ELISAs

Search LifeMap BioReagents cell lines for TRIM50

	Gene Synthesis
	Protein Engineering
	Variant Library Synthesis
	Codon Optimization
	Protein Production and Purification

Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for TRIM50

	SwitchGear 3'UTR luciferase reporter plasmids for TRIM50
	SwitchGear Promoter luciferase reporter plasmids for TRIM50

Search ThermoFisher Antibodies for TRIM50

Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat TRIM50

GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

View Random Gene

Category			VWF (GIFTS: 73) von Willebrand factor
GIFtS Group

The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

The GeneCards Human Gene Database

Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

Hot genes Disease genes TRIM50 gene at Home site.

hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4

Advanced Search

Export list of displayed genes

TRIM50 Gene

tripartite motif containing 50

Aliases
for TRIM50 gene

Summaries
for TRIM50 gene

Genomic Views
for TRIM50 gene

Proteins
for TRIM50 gene

Protein Domains /
Families
for TRIM50 gene

Function
for TRIM50 gene

Pathways & Interactions
for TRIM50 gene

Drugs & Compounds
for TRIM50 gene

Transcripts
for TRIM50 gene

Expression
for TRIM50 gene

Orthologs
for TRIM50 gene

Paralogs
for TRIM50 gene

Genomic Variants
for TRIM50 gene

Disorders / Diseases
for TRIM50 gene

Publications
for TRIM50 gene

External Searches for TRIM50 gene

Genome Databases showing TRIM50 gene

Other Databases showing TRIM50 gene

Specialized Databases showing TRIM50 gene

Intellectual Property
for TRIM50 gene

Products
for TRIM50 gene

View Random Gene

Advanced Search

Export list of displayed genes

TRIM50 Gene

tripartite motif containing 50

Aliasesfor TRIM50 gene

Summariesfor TRIM50 gene

Genomic Viewsfor TRIM50 gene

Proteinsfor TRIM50 gene

Protein Domains /Familiesfor TRIM50 gene

Functionfor TRIM50 gene

Pathways & Interactionsfor TRIM50 gene

Drugs & Compoundsfor TRIM50 gene

Transcriptsfor TRIM50 gene

Expression for TRIM50 gene

Orthologsfor TRIM50 gene

Paralogsfor TRIM50 gene

Genomic Variantsfor TRIM50 gene

Disorders / Diseasesfor TRIM50 gene

Publicationsfor TRIM50 gene

External Searches for TRIM50 gene

Genome Databases showing TRIM50 gene

Other Databases showing TRIM50 gene

Specialized Databases showing TRIM50 gene

Intellectual Propertyfor TRIM50 gene

Productsfor TRIM50 gene

View Random Gene

Aliases
for TRIM50 gene

Summaries
for TRIM50 gene

Genomic Views
for TRIM50 gene

Proteins
for TRIM50 gene

Protein Domains /
Families
for TRIM50 gene

Function
for TRIM50 gene

Pathways & Interactions
for TRIM50 gene

Drugs & Compounds
for TRIM50 gene

Transcripts
for TRIM50 gene

Expression
for TRIM50 gene

Orthologs
for TRIM50 gene

Paralogs
for TRIM50 gene

Genomic Variants
for TRIM50 gene

Disorders / Diseases
for TRIM50 gene

Publications
for TRIM50 gene

Intellectual Property
for TRIM50 gene

Products
for TRIM50 gene