Free for academic non-profit institutions. Other users need a Commercial license

Aliases for TNK2 Gene

Aliases for TNK2 Gene

  • Tyrosine Kinase Non Receptor 2 2 3 5
  • Tyrosine Kinase Non-Receptor Protein 2 3 4
  • Activated Cdc42-Associated Kinase 1 2 3
  • EC 2.7.10.2 4 61
  • ACK-1 3 4
  • ACK1 3 4
  • Tyrosine Kinase, Non-Receptor, 2 2
  • Activated P21cdc42Hs Kinase 3
  • Activated CDC42 Kinase 1 3
  • EC 2.7.11.1 4
  • P21cdc42Hs 3
  • EC 2.7.10 61
  • ACK 3

External Ids for TNK2 Gene

Previous GeneCards Identifiers for TNK2 Gene

  • GC03M197080
  • GC03M195590
  • GC03M192870

Summaries for TNK2 Gene

Entrez Gene Summary for TNK2 Gene

  • This gene encodes a tyrosine kinase that binds Cdc42Hs in its GTP-bound form and inhibits both the intrinsic and GTPase-activating protein (GAP)-stimulated GTPase activity of Cdc42Hs. This binding is mediated by a unique sequence of 47 amino acids C-terminal to an SH3 domain. The protein may be involved in a regulatory mechanism that sustains the GTP-bound active form of Cdc42Hs and which is directly linked to a tyrosine phosphorylation signal transduction pathway. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq, Jul 2008]

GeneCards Summary for TNK2 Gene

TNK2 (Tyrosine Kinase Non Receptor 2) is a Protein Coding gene. Diseases associated with TNK2 include Infantile-Onset Mesial Temporal Lobe Epilepsy With Severe Cognitive Regression. Among its related pathways are G-protein signaling_Regulation of CDC42 activity and EGFR1 Signaling Pathway. GO annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is TNK1.

UniProtKB/Swiss-Prot for TNK2 Gene

  • Non-receptor tyrosine-protein and serine/threonine-protein kinase that is implicated in cell spreading and migration, cell survival, cell growth and proliferation. Transduces extracellular signals to cytosolic and nuclear effectors. Phosphorylates AKT1, AR, MCF2, WASL and WWOX. Implicated in trafficking and clathrin-mediated endocytosis through binding to epidermal growth factor receptor (EGFR) and clathrin. Binds to both poly- and mono-ubiquitin and regulates ligand-induced degradation of EGFR, thereby contributing to the accumulation of EGFR at the limiting membrane of early endosomes. Downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. May be involved both in adult synaptic function and plasticity and in brain development. Activates AKT1 by phosphorylating it on Tyr-176. Phosphorylates AR on Tyr-267 and Tyr-363 thereby promoting its recruitment to androgen-responsive enhancers (AREs). Phosphorylates WWOX on Tyr-287. Phosphorylates MCF2, thereby enhancing its activity as a guanine nucleotide exchange factor (GEF) toward Rho family proteins. Contributes to the control of AXL receptor levels. Confers metastatic properties on cancer cells and promotes tumor growth by negatively regulating tumor suppressor such as WWOX and positively regulating pro-survival factors such as AKT1 and AR.

Gene Wiki entry for TNK2 Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for TNK2 Gene

Genomics for TNK2 Gene

Regulatory Elements for TNK2 Gene

Enhancers for TNK2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH03F196188 1.7 FANTOM5 Ensembl ENCODE 4.5 -281.0 -280956 8.6 HDGF PKNOX1 ARID4B YBX1 ZNF48 ZNF121 GLIS2 ELK1 GATA2 ZNF143 ENSG00000226345 ENSG00000213358 RPS29P3 RNU7-18P TFRC TM4SF19 RNU6-910P SLC51A UBXN7 LINC00885
GH03F195905 1.7 FANTOM5 Ensembl ENCODE 4.1 +3.0 3037 7.0 HDGF PKNOX1 WRNIP1 ZFP64 ARID4B SIN3A YBX1 FEZF1 ZNF2 FOS ENSG00000271662 SDHAP2 ENSG00000226345 ENSG00000213358 RPS29P3 LINC00969 MUC20 TNK2-AS1 ENSG00000231443 PPP1R2
GH03F195869 0.6 ENCODE 10.1 +41.2 41235 2.3 CREB3L1 NR2F1 MAX MNT ZIC2 ZFHX2 GLIS1 MYC EGR2 RNU2-11P MUC4 TNK2 SDHAP2 ENSG00000229178 GC03P195867 PIR40505
GH03F195899 1.1 FANTOM5 ENCODE 4 +10.9 10890 3.5 HDGF CTCF ZBTB2 MAX CEBPB CEBPG MNT ZFHX2 POLR2A EED ENSG00000271662 LINC00969 ACAP2 LOC100131360 MUC20 TNK2-AS1 SDHAP2 PPP1R2 TNK2 PCYT1A
GH03F196170 1.5 FANTOM5 Ensembl ENCODE 2.5 -259.4 -259439 1.6 TBL1XR1 INSM2 KLF17 SIN3A ZNF2 RAD21 RARA ZNF121 ZNF335 GLIS2 TFRC RNU7-18P SLC51A PCYT1A UBXN7 NRROS RNF168 TNK2 TM4SF19 GC03P196177
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around TNK2 on UCSC Golden Path with GeneCards custom track

Genomic Location for TNK2 Gene

Chromosome:
3
Start:
195,863,364 bp from pter
End:
195,911,945 bp from pter
Size:
48,582 bases
Orientation:
Minus strand

Genomic View for TNK2 Gene

Genes around TNK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
TNK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for TNK2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for TNK2 Gene

Proteins for TNK2 Gene

  • Protein details for TNK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q07912-ACK1_HUMAN
    Recommended name:
    Activated CDC42 kinase 1
    Protein Accession:
    Q07912
    Secondary Accessions:
    • Q6ZMQ0
    • Q8N6U7
    • Q96H59

    Protein attributes for TNK2 Gene

    Size:
    1038 amino acids
    Molecular mass:
    114569 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Interacts with NEDD4 (via WW3 domain). NEDD4L and EGF promote association with NEDD4 (By similarity). Homodimer. Interacts with AR, CDC42, WWASL and WWOX. Interacts with CSPG4 (activated). Interacts with MERTK (activated); stimulates autophosphorylation. May interact (phosphorylated) with HSP90AB1; maintains kinase activity. Interacts with NPHP1. Interacts with SNX9 (via SH3 domain). Interacts with SRC (via SH2 and SH3 domain). Interacts with EGFR, and this interaction is dependent on EGF stimulation and kinase activity of EGFR. Interacts (via kinase domain) with AKT1. Part of a collagen stimulated complex involved in cell migration composed of CDC42, CRK, TNK2 and BCAR1/p130cas. Interacts with BCAR1/p130cas via SH3 domains. Forms complexes with GRB2 and numerous receptor tyrosine kinases (RTK) including LTK, AXL or PDGFRL, in which GRB2 promotes RTK recruitment by TNK2.
    SequenceCaution:
    • Sequence=AAH08884.1; Type=Miscellaneous discrepancy; Note=Unlikely isoform. Aberrant splice sites.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for TNK2 Gene

    Alternative splice isoforms for TNK2 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for TNK2 Gene

Selected DME Specific Peptides for TNK2 Gene

Q07912:
  • RDLAARN
  • LQSLTCLIGEKDL
  • GERLPRP
  • LPRGLWLAKPSARVPGTKA
  • TYDPVSED
  • KVPFAWC
  • GKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNL
  • RPCAPSLAQLAMDACSLLD
  • SFIHTGHGD
  • FGVVRRG
  • WMFGVTLWEMF
  • HSQSTFRK
  • TPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDE

Post-translational modifications for TNK2 Gene

  • Autophosphorylation regulates kinase activity. Phosphorylation on Tyr-518 is required for interaction with SRC and is observed during association with clathrin-coated pits.
  • Polyubiquitinated by NEDD4 and NEDD4L. Degradation can be induced by EGF and is lysosome-dependent (By similarity).
  • Ubiquitination at Lys 1037
  • Modification sites at PhosphoSitePlus

Domains & Families for TNK2 Gene

Gene Families for TNK2 Gene

Suggested Antigen Peptide Sequences for TNK2 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q07912

UniProtKB/Swiss-Prot:

ACK1_HUMAN :
  • The EBD (EGFR-binding domain) domain is necessary for interaction with EGFR.
  • Belongs to the protein kinase superfamily. Tyr protein kinase family.
Domain:
  • The EBD (EGFR-binding domain) domain is necessary for interaction with EGFR.
  • The SAM-like domain is necessary for NEDD4-mediated ubiquitination. Promotes membrane localization and dimerization to allow for autophosphorylation.
  • The UBA domain binds both poly- and mono-ubiquitin.
  • Contains 1 CRIB domain.
  • Contains 1 protein kinase domain.
  • Contains 1 SH3 domain.
  • Contains 1 UBA domain.
Family:
  • Belongs to the protein kinase superfamily. Tyr protein kinase family.
genes like me logo Genes that share domains with TNK2: view

Function for TNK2 Gene

Molecular function for TNK2 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by AIM-100 (4-amino-5,6-biaryl-furo[2,3-d]pyrimidine), which suppresses activating phosphorylation at Tyr-284. Repressed by dasatinib.
UniProtKB/Swiss-Prot Function:
Non-receptor tyrosine-protein and serine/threonine-protein kinase that is implicated in cell spreading and migration, cell survival, cell growth and proliferation. Transduces extracellular signals to cytosolic and nuclear effectors. Phosphorylates AKT1, AR, MCF2, WASL and WWOX. Implicated in trafficking and clathrin-mediated endocytosis through binding to epidermal growth factor receptor (EGFR) and clathrin. Binds to both poly- and mono-ubiquitin and regulates ligand-induced degradation of EGFR, thereby contributing to the accumulation of EGFR at the limiting membrane of early endosomes. Downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. May be involved both in adult synaptic function and plasticity and in brain development. Activates AKT1 by phosphorylating it on Tyr-176. Phosphorylates AR on Tyr-267 and Tyr-363 thereby promoting its recruitment to androgen-responsive enhancers (AREs). Phosphorylates WWOX on Tyr-287. Phosphorylates MCF2, thereby enhancing its activity as a guanine nucleotide exchange factor (GEF) toward Rho family proteins. Contributes to the control of AXL receptor levels. Confers metastatic properties on cancer cells and promotes tumor growth by negatively regulating tumor suppressor such as WWOX and positively regulating pro-survival factors such as AKT1 and AR.

Enzyme Numbers (IUBMB) for TNK2 Gene

Gene Ontology (GO) - Molecular Function for TNK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0004712 protein serine/threonine/tyrosine kinase activity IDA 16257963
GO:0004713 protein tyrosine kinase activity IEA,IDA 18993068
GO:0004715 non-membrane spanning protein tyrosine kinase activity IEA,TAS --
genes like me logo Genes that share ontologies with TNK2: view
genes like me logo Genes that share phenotypes with TNK2: view

Animal Model Products

  • Taconic Biosciences Mouse Models for TNK2

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for TNK2 Gene

Localization for TNK2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for TNK2 Gene

Cell membrane. Nucleus. Endosome. Cell junction, adherens junction. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle, clathrin-coated vesicle. Membrane, clathrin-coated pit. Note=The Tyr-284 phosphorylated form is found both in the membrane and nucleus. Colocalizes with EGFR on endosomes. Nuclear translocation is CDC42-dependent.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for TNK2 gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 4
endosome 4
cytoskeleton 1

Gene Ontology (GO) - Cellular Components for TNK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 20333297
GO:0005737 cytoplasm IDA 20979614
GO:0005768 endosome ISS --
GO:0005886 plasma membrane IEA,IDA 20333297
GO:0005905 clathrin-coated pit IEA,IDA 21169560
genes like me logo Genes that share ontologies with TNK2: view

Pathways & Interactions for TNK2 Gene

genes like me logo Genes that share pathways with TNK2: view

Pathways by source for TNK2 Gene

1 Cell Signaling Technology pathway for TNK2 Gene
1 Qiagen pathway for TNK2 Gene

SIGNOR curated interactions for TNK2 Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for TNK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0006897 endocytosis IEA --
GO:0007166 cell surface receptor signaling pathway TAS 20432460
GO:0007169 transmembrane receptor protein tyrosine kinase signaling pathway IBA --
GO:0007264 small GTPase mediated signal transduction TAS 8497321
genes like me logo Genes that share ontologies with TNK2: view

Drugs & Compounds for TNK2 Gene

(6) Drugs for TNK2 Gene - From: DrugBank, ApexBio, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra Target 0
Debromohymenialdisine Experimental Pharma Target 0
AIM-100 Pharma Ack1 inhibitor, Potent and selective Ack1 (TNK2) inhibitor 0
Magnesium Nutra 0

(1) Additional Compounds for TNK2 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0

(1) ApexBio Compounds for TNK2 Gene

Compound Action Cas Number
AIM-100 Ack1 inhibitor 873305-35-2
genes like me logo Genes that share compounds with TNK2: view

Transcripts for TNK2 Gene

Unigene Clusters for TNK2 Gene

Tyrosine kinase, non-receptor, 2:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for TNK2 Gene

ExUns: 1 ^ 2 ^ 3a · 3b · 3c ^ 4 ^ 5 ^ 6 ^ 7 ^ 8a · 8b ^ 9 ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b · 13c ^ 14a · 14b · 14c ^ 15 ^ 16a · 16b ^ 17a ·
SP1: - - - - - - - -
SP2: - - -
SP3: - - -
SP4: - - - - - - - - - - - - -
SP5: - - - - - - - -
SP6: - - - - - -
SP7: -
SP8: - - -
SP9:
SP10: - - - - - - -
SP11: - - - - -
SP12: - - - - -
SP13:
SP14:
SP15:
SP16:
SP17:
SP18:
SP19:
SP20:
SP21:
SP22: - - - - - - - - - - - - - - - - - - - - -
SP23:
SP24:

ExUns: 17b · 17c ^ 18 ^ 19a · 19b ^ 20a · 20b · 20c · 20d ^ 21 ^ 22a · 22b ^ 23a · 23b · 23c · 23d · 23e · 23f ^ 24 ^ 25 ^ 26 ^ 27a · 27b ^ 28 ^ 29a · 29b ^
SP1: - - - - -
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8: - - - - -
SP9: - - - - - - -
SP10:
SP11:
SP12:
SP13:
SP14: - - -
SP15:
SP16:
SP17: - - - - - -
SP18: - - - -
SP19: - - -
SP20:
SP21:
SP22: - - - - - - - - - -
SP23:
SP24:

ExUns: 30 ^ 31 ^ 32 ^ 33a · 33b ^ 34
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:
SP18:
SP19:
SP20: -
SP21:
SP22:
SP23:
SP24:

Relevant External Links for TNK2 Gene

GeneLoc Exon Structure for
TNK2
ECgene alternative splicing isoforms for
TNK2

Expression for TNK2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for TNK2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for TNK2 Gene

This gene is overexpressed in Plasma (42.1), Lung (12.6), and Pancreatic juice (12.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for TNK2 Gene



Protein tissue co-expression partners for TNK2 Gene

NURSA nuclear receptor signaling pathways regulating expression of TNK2 Gene:

TNK2

SOURCE GeneReport for Unigene cluster for TNK2 Gene:

Hs.518513

mRNA Expression by UniProt/SwissProt for TNK2 Gene:

Q07912-ACK1_HUMAN
Tissue specificity: The Tyr-284 phosphorylated form shows a significant increase in expression in breast cancers during the progressive stages i.e. normal to hyperplasia (ADH), ductal carcinoma in situ (DCIS), invasive ductal carcinoma (IDC) and lymph node metastatic (LNMM) stages. It also shows a significant increase in expression in prostate cancers during the progressive stages.
genes like me logo Genes that share expression patterns with TNK2: view

Primer Products

No data available for mRNA differential expression in normal tissues for TNK2 Gene

Orthologs for TNK2 Gene

This gene was present in the common ancestor of animals.

Orthologs for TNK2 Gene

Organism Taxonomy Gene Similarity Type Details
cow
(Bos Taurus)
Mammalia BT.64988 35
  • 92 (a)
OneToOne
TNK2 34
  • 91.19 (n)
dog
(Canis familiaris)
Mammalia TNK2 34 35
  • 90.57 (n)
rat
(Rattus norvegicus)
Mammalia Tnk2 34
  • 88.05 (n)
mouse
(Mus musculus)
Mammalia Tnk2 34 16 35
  • 87.7 (n)
oppossum
(Monodelphis domestica)
Mammalia TNK2 35
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves TNK2 34 35
  • 75.03 (n)
tropical clawed frog
(Silurana tropicalis)
Amphibia tnk2 34
  • 65.98 (n)
Str.9615 34
zebrafish
(Danio rerio)
Actinopterygii LOC559119 34
  • 67.53 (n)
tnk2b 35
  • 62 (a)
OneToMany
CT476804.2 35
  • 58 (a)
OneToMany
tnk2a 35
  • 58 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta Ack 35
  • 34 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea sid-3 35
  • 24 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 60 (a)
OneToMany
Species where no ortholog for TNK2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chimpanzee (Pan troglodytes)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • lizard (Anolis carolinensis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • platypus (Ornithorhynchus anatinus)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for TNK2 Gene

ENSEMBL:
Gene Tree for TNK2 (if available)
TreeFam:
Gene Tree for TNK2 (if available)

Paralogs for TNK2 Gene

Paralogs for TNK2 Gene

genes like me logo Genes that share paralogs with TNK2: view

Variants for TNK2 Gene

Sequence variations from dbSNP and Humsavar for TNK2 Gene

SNP ID Clin Chr 03 pos Sequence Context AA Info Type
rs113498671 An ovarian mucinous carcinoma sample 195,884,972(+) TCTTC(C/T)GGAAG upstream-variant-2KB, reference, missense, utr-variant-5-prime
VAR_032792 A lung adenocarcinoma sample
VAR_032797 An ovarian endometrioid cancer sample
VAR_032798 A gastric adenocarcinoma sample
rs112384084 Likely pathogenic 195,867,623(+) CCTCA(C/T)GCAGG reference, missense

Structural Variations from Database of Genomic Variants (DGV) for TNK2 Gene

Variant ID Type Subtype PubMed ID
nsv950306 CNV deletion 24416366
nsv829827 CNV gain+loss 17160897
nsv822410 CNV loss 20364138
nsv593064 CNV loss 21841781
nsv593060 CNV gain+loss 21841781
nsv593059 CNV loss 21841781
nsv593058 CNV gain 21841781
nsv593057 CNV gain 21841781
nsv593056 CNV loss 21841781
nsv471828 CNV novel sequence insertion 20440878
nsv471621 CNV gain+loss 15918152
nsv469518 CNV gain+loss 16826518
nsv428430 CNV gain+loss 18775914
nsv1123730 CNV deletion 24896259
nsv1117361 CNV tandem duplication 24896259
nsv1074118 CNV deletion 25765185
nsv1068315 OTHER inversion 25765185
nsv1014602 CNV gain 25217958
nsv1011404 CNV gain 25217958
nsv1007235 CNV gain 25217958
nsv1006165 CNV gain 25217958
nsv1005193 CNV loss 25217958
nsv1002629 CNV gain 25217958
nsv1001387 CNV gain 25217958
esv3893851 CNV loss 25118596
esv3893850 CNV gain 25118596
esv3563166 CNV deletion 23714750
esv28378 CNV gain 19812545
esv2759213 CNV gain+loss 17122850
esv2751988 CNV gain 17911159
esv2726539 CNV deletion 23290073
esv2726538 CNV deletion 23290073
esv2726533 CNV deletion 23290073
esv2726532 CNV deletion 23290073
esv2726531 CNV deletion 23290073
esv2726530 CNV deletion 23290073
esv2726528 CNV deletion 23290073
esv2726527 CNV deletion 23290073
esv2726526 CNV deletion 23290073
esv22999 CNV loss 19812545
esv1214939 CNV deletion 17803354
dgv8847n54 CNV gain 21841781
dgv8846n54 CNV gain 21841781
dgv788e201 CNV deletion 23290073
dgv787e201 CNV deletion 23290073
dgv5034n100 CNV gain 25217958
dgv2683n106 OTHER inversion 24896259

Variation tolerance for TNK2 Gene

Residual Variation Intolerance Score: 76.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.46; 71.58% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for TNK2 Gene

Human Gene Mutation Database (HGMD)
TNK2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
TNK2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TNK2 Gene

Disorders for TNK2 Gene

MalaCards: The human disease database

(1) MalaCards diseases for TNK2 Gene - From: Orphanet

- elite association - COSMIC cancer census association via MalaCards
Search TNK2 in MalaCards View complete list of genes associated with diseases

Relevant External Links for TNK2

Human Genome Epidemiology (HuGE) Navigator
TNK2
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
TNK2
genes like me logo Genes that share disorders with TNK2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for TNK2 Gene

Publications for TNK2 Gene

  1. Shepherding AKT and androgen receptor by Ack1 tyrosine kinase. (PMID: 20432460) Mahajan K. … Mahajan N.P. (J. Cell. Physiol. 2010) 3 4 22 64
  2. Down-regulation of active ACK1 is mediated by association with the E3 ubiquitin ligase Nedd4-2. (PMID: 19144635) Chan W. … Manser E. (J. Biol. Chem. 2009) 3 4 22 64
  3. Cytoplasmic ACK1 interaction with multiple receptor tyrosine kinases is mediated by Grb2: an analysis of ACK1 effects on Axl signaling. (PMID: 19815557) Pao-Chun L. … Manser E. (J. Biol. Chem. 2009) 3 4 22 64
  4. Dysregulation of Ack1 inhibits down-regulation of the EGF receptor. (PMID: 18262180) Groevdal L.M. … Stang E. (Exp. Cell Res. 2008) 3 4 22 64
  5. Activated Cdc42-associated kinase Ack1 promotes prostate cancer progression via androgen receptor tyrosine phosphorylation. (PMID: 17494760) Mahajan N.P. … Whang Y.E. (Proc. Natl. Acad. Sci. U.S.A. 2007) 3 4 22 64

Products for TNK2 Gene

Sources for TNK2 Gene

Content
Loading form....