Free for academic non-profit institutions. Other users need a Commercial license

Aliases for TAOK3 Gene

Aliases for TAOK3 Gene

  • TAO Kinase 3 2 3 5
  • Cutaneous T-Cell Lymphoma-Associated Antigen HD-CL-09 3 4
  • Dendritic Cell-Derived Protein Kinase 3 4
  • Thousand And One Amino Acid Protein 3 3 4
  • CTCL-Associated Antigen HD-CL-09 3 4
  • Kinase From Chicken Homolog A 3 4
  • Jun Kinase-Inhibitory Kinase 3 4
  • JNK/SAPK-Inhibitory Kinase 3 4
  • EC 2.7.11.1 4 58
  • MAP3K18 3 4
  • HKFC-A 3 4
  • DPK 3 4
  • JIK 3 4
  • Serine/Threonine-Protein Kinase TAO3 3
  • STE20-Like Kinase 3
  • EC 2.7.11 58
  • KDS 4

External Ids for TAOK3 Gene

Previous GeneCards Identifiers for TAOK3 Gene

  • GC12M117050
  • GC12M118587
  • GC12M115597

Summaries for TAOK3 Gene

Entrez Gene Summary for TAOK3 Gene

  • The protein encoded by this gene is a serine/threonine protein kinase that activates the p38/MAPK14 stress-activated MAPK cascade but inhibits the basal activity of the MAPK8/JNK cascade. The encoded protein is a member of the GCK subfamily of STE20-like kinases. [provided by RefSeq, Oct 2016]

GeneCards Summary for TAOK3 Gene

TAOK3 (TAO Kinase 3) is a Protein Coding gene. Diseases associated with TAOK3 include Cardiomyopathy, Familial Hypertrophic, 9 and Charcot-Marie-Tooth Disease, Axonal, Type 2L. Among its related pathways are p38 MAPK signaling pathway (Pathway Interaction Database) and MAPK signaling pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is TAOK1.

UniProtKB/Swiss-Prot for TAOK3 Gene

  • Serine/threonine-protein kinase that acts as a regulator of the p38/MAPK14 stress-activated MAPK cascade and of the MAPK8/JNK cascade. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. Inhibits basal activity of MAPK8/JNK cascade and diminishes its activation in response epidermal growth factor (EGF).

Gene Wiki entry for TAOK3 Gene

Additional gene information for TAOK3 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for TAOK3 Gene

Genomics for TAOK3 Gene

Regulatory Elements for TAOK3 Gene

Enhancers for TAOK3 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH12H118328 1.5 Ensembl ENCODE dbSUPER 13.3 +42.3 42331 3 PKNOX1 ATF1 ARNT TCF12 ZNF766 GATA2 ELK1 NCOA1 MEF2D MBD2 SUDS3 TAOK3 PEBP1 RPS2P5
GH12H118311 1 ENCODE dbSUPER 12.9 +59.7 59733 3 SMARCA5 PKNOX1 ZBED1 BACH1 JUNB DPF2 BATF ZNF217 PRDM6 BCL11A SUDS3 TAOK3 PEBP1 RPS2P5
GH12H118332 0.9 Ensembl dbSUPER 13.3 +40.3 40340 0 CEBPB CEBPG ZNF518A ZNF664 POLR2A ZSCAN5C IKZF1 ZNF629 CEBPA ZNF600 TAOK3 SUDS3 RPS2P5
GH12H118288 0.7 ENCODE 11.9 +84.5 84543 0 HDAC1 LEF1 TAL1 TCF12 NCOR1 EGR1 SCRT2 TRIM24 ATF7 EGR2 TAOK3 SUDS3 RPS2P5
GH12H118287 0.6 dbSUPER 12 +85.1 85124 0 HDAC1 SMARCE1 LEF1 TAL1 ZNF592 TCF12 SMARCA4 HMBOX1 ATF7 TRIM24 SUDS3 TAOK3 LOC100287653 RPS2P5
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around TAOK3 on UCSC Golden Path with GeneCards custom track

Promoters for TAOK3 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000058185 745 2801 PKNOX1 FOXA2 ARNT ARID4B SIN3A DMAP1 ZBTB7B YY1 CBX5 ZNF143

Genomic Location for TAOK3 Gene

Chromosome:
12
Start:
118,149,801 bp from pter
End:
118,372,945 bp from pter
Size:
223,145 bases
Orientation:
Minus strand

Genomic View for TAOK3 Gene

Genes around TAOK3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
TAOK3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for TAOK3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for TAOK3 Gene

Proteins for TAOK3 Gene

  • Protein details for TAOK3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9H2K8-TAOK3_HUMAN
    Recommended name:
    Serine/threonine-protein kinase TAO3
    Protein Accession:
    Q9H2K8
    Secondary Accessions:
    • Q658N1
    • Q8IUM4
    • Q9HC79
    • Q9NZM9
    • Q9UHG7

    Protein attributes for TAOK3 Gene

    Size:
    898 amino acids
    Molecular mass:
    105406 Da
    Quaternary structure:
    • Self-associates. Interacts with ERN1 and TRAF2. Interaction with TRAF2 is facilitated under ER stress conditions, such as treatment with tunicamycin, and may promote TRAF2 phosphorylation.
    SequenceCaution:
    • Sequence=AAN09723.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};

neXtProt entry for TAOK3 Gene

Selected DME Specific Peptides for TAOK3 Gene

Q9H2K8:
  • DIKAGNIL
  • AAADEKKFQQQILAQQKKD
  • KKMSYSGKQ
  • ELLNAYQSKIK
  • LQHQTEL
  • AQQKKDLT
  • DLIQRTKDAVRELDNLQYRKMKKILFQE
  • DEAQEAECQ
  • QALRLDE
  • LEQRVSL
  • QIKKQFQ
  • NEDHSTPKKEKQERISKHKENLQHTQAEEEA
  • RERFATIKSASLVTRQIHEHEQENELREQMSGYKRMRRQ
  • EIGHGSFGAVYFA
  • RPTQSVQ
  • WSLGITCIELAER
  • VKLADFG
  • ALQKERSERIK
  • LLERQERE
  • EYKGCYL
  • KAGNILL
  • MNAMSALYHIAQN
  • SGYKRMRRQHQKQL
  • HRDIKAGN
  • WMAPEVI
  • EQTRKLAILAEQY
  • DESTRELEYRQL
  • KEAKVAAADE
  • IREELNKKRTQKEMEHAMLIR
  • GTPYWMAPE
  • VLIDLIQRTKDAVRELDNLQYRKMKK
  • NQLEYNKRRE

Post-translational modifications for TAOK3 Gene

  • Autophosphorylated. Phosphorylation at Ser-324 by ATM following DNA damage is required for activation of the p38/MAPK14 stress-activated MAPK cascade. Phosphorylated by LRRK2.
  • Ubiquitination at Lys260 and posLast=855855
  • Modification sites at PhosphoSitePlus

Domains & Families for TAOK3 Gene

Gene Families for TAOK3 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Protein Domains for TAOK3 Gene

Suggested Antigen Peptide Sequences for TAOK3 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9H2K8

UniProtKB/Swiss-Prot:

TAOK3_HUMAN :
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
genes like me logo Genes that share domains with TAOK3: view

Function for TAOK3 Gene

Molecular function for TAOK3 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase that acts as a regulator of the p38/MAPK14 stress-activated MAPK cascade and of the MAPK8/JNK cascade. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. Inhibits basal activity of MAPK8/JNK cascade and diminishes its activation in response epidermal growth factor (EGF).

Enzyme Numbers (IUBMB) for TAOK3 Gene

Phenotypes From GWAS Catalog for TAOK3 Gene

Gene Ontology (GO) - Molecular Function for TAOK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IDA 10559204
GO:0004709 MAP kinase kinase kinase activity IBA --
GO:0004860 protein kinase inhibitor activity TAS 10559204
genes like me logo Genes that share ontologies with TAOK3: view
genes like me logo Genes that share phenotypes with TAOK3: view

Animal Model Products

  • Taconic Biosciences Mouse Models for TAOK3

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for TAOK3
  • Applied Biological Materials Clones for TAOK3
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for TAOK3 Gene

Localization for TAOK3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for TAOK3 Gene

Cytoplasm. Cell membrane; Peripheral membrane protein. Note=Also localized to the peripheral cell membrane.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for TAOK3 gene
Compartment Confidence
plasma membrane 4
cytosol 4
mitochondrion 3
nucleus 2
extracellular 1
cytoskeleton 1
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for TAOK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IBA --
GO:0005886 plasma membrane IEA --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with TAOK3: view

Pathways & Interactions for TAOK3 Gene

genes like me logo Genes that share pathways with TAOK3: view

Pathways by source for TAOK3 Gene

1 Sino Biological pathway for TAOK3 Gene
1 BioSystems pathway for TAOK3 Gene
1 KEGG pathway for TAOK3 Gene

SIGNOR curated interactions for TAOK3 Gene

Activates:

Gene Ontology (GO) - Biological Process for TAOK3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade IMP 10924369
GO:0000186 activation of MAPKK activity IEA --
GO:0006281 DNA repair IEA --
GO:0006468 protein phosphorylation IEA,IMP 11278723
GO:0006469 negative regulation of protein kinase activity IEA --
genes like me logo Genes that share ontologies with TAOK3: view

Drugs & Compounds for TAOK3 Gene

(1) Drugs for TAOK3 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
ATP Nutra Agonist 0

(1) Additional Compounds for TAOK3 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with TAOK3: view

Transcripts for TAOK3 Gene

Unigene Clusters for TAOK3 Gene

TAO kinase 3:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for TAOK3
  • Applied Biological Materials Clones for TAOK3
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for TAOK3 Gene

No ASD Table

Relevant External Links for TAOK3 Gene

GeneLoc Exon Structure for
TAOK3
ECgene alternative splicing isoforms for
TAOK3

Expression for TAOK3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for TAOK3 Gene

Protein differential expression in normal tissues from HIPED for TAOK3 Gene

This gene is overexpressed in Lymph node (15.2), Peripheral blood mononuclear cells (12.8), and CD8 Tcells (7.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for TAOK3 Gene



Protein tissue co-expression partners for TAOK3 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of TAOK3 Gene:

TAOK3

SOURCE GeneReport for Unigene cluster for TAOK3 Gene:

Hs.644420

mRNA Expression by UniProt/SwissProt for TAOK3 Gene:

Q9H2K8-TAOK3_HUMAN
Tissue specificity: Ubiquitously expressed at a low level, and highly expressed in peripheral blood leukocytes (PBLs), thymus, spleen, kidney, skeletal muscle, heart and liver.

Evidence on tissue expression from TISSUES for TAOK3 Gene

  • Blood(4.5)
  • Liver(4.4)
  • Lymph node(4.3)
  • Spleen(4.3)
  • Stomach(4.2)
  • Nervous system(4.2)
  • Kidney(2.2)
  • Muscle(2.1)
genes like me logo Genes that share expression patterns with TAOK3: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for TAOK3 Gene

Orthologs for TAOK3 Gene

This gene was present in the common ancestor of animals.

Orthologs for TAOK3 Gene

Organism Taxonomy Gene Similarity Type Details
dog
(Canis familiaris)
Mammalia TAOK3 33 34
  • 95.88 (n)
cow
(Bos Taurus)
Mammalia TAOK3 33 34
  • 95.51 (n)
chimpanzee
(Pan troglodytes)
Mammalia TAOK3 33 34
  • 95.42 (n)
oppossum
(Monodelphis domestica)
Mammalia TAOK3 34
  • 95 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Taok3 33 16 34
  • 88.53 (n)
rat
(Rattus norvegicus)
Mammalia Taok3 33
  • 87.86 (n)
chicken
(Gallus gallus)
Aves TAOK3 33 34
  • 85.37 (n)
lizard
(Anolis carolinensis)
Reptilia TAOK3 34
  • 94 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia Str.18944 33
zebrafish
(Danio rerio)
Actinopterygii taok3a 33 34
  • 74.91 (n)
taok3b 34
  • 70 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta Tao 34
  • 47 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea kin-18 34
  • 36 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 43 (a)
OneToMany
Species where no ortholog for TAOK3 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • platypus (Ornithorhynchus anatinus)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for TAOK3 Gene

ENSEMBL:
Gene Tree for TAOK3 (if available)
TreeFam:
Gene Tree for TAOK3 (if available)

Paralogs for TAOK3 Gene

Variants for TAOK3 Gene

Sequence variations from dbSNP and Humsavar for TAOK3 Gene

SNP ID Clin Chr 12 pos Sequence Context AA Info Type
VAR_041205 A lung adenocarcinoma sample
VAR_041206 A lung small cell carcinoma sample
rs864622030 Uncertain significance 118,235,597(-) TTCAA(C/T)GGCTT reference, missense
rs1000027846 -- 118,322,158(+) AAAAG(C/T)ACAAA intron-variant
rs1000029236 -- 118,287,109(+) ATTGT(G/T)TGCAG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for TAOK3 Gene

Variant ID Type Subtype PubMed ID
esv1533353 CNV deletion 17803354
esv2662690 CNV deletion 23128226
esv3580497 CNV loss 25503493
esv3581916 CNV gain 25503493
esv3630885 CNV loss 21293372
esv3630886 CNV loss 21293372
esv3630887 CNV loss 21293372
nsv513369 CNV insertion 21212237
nsv524938 CNV gain 19592680
nsv560390 CNV loss 21841781
nsv973125 CNV duplication 23825009

Variation tolerance for TAOK3 Gene

Residual Variation Intolerance Score: 19.6% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.59; 30.73% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for TAOK3 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
TAOK3

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for TAOK3 Gene

Disorders for TAOK3 Gene

MalaCards: The human disease database

(2) MalaCards diseases for TAOK3 Gene - From: DISEASES

Disorder Aliases PubMed IDs
cardiomyopathy, familial hypertrophic, 9
  • hypertrophic cardiomyopathy 9
charcot-marie-tooth disease, axonal, type 2l
  • charcot-marie-tooth disease, type 2i
- elite association - COSMIC cancer census association via MalaCards
Search TAOK3 in MalaCards View complete list of genes associated with diseases

Relevant External Links for TAOK3

Genetic Association Database (GAD)
TAOK3
Human Genome Epidemiology (HuGE) Navigator
TAOK3
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
TAOK3
genes like me logo Genes that share disorders with TAOK3: view

No data available for UniProtKB/Swiss-Prot and Genatlas for TAOK3 Gene

Publications for TAOK3 Gene

  1. Cloning of DPK, a novel dendritic cell-derived protein kinase activating the ERK1/ERK2 and JNK/SAPK pathways. (PMID: 10924369) Zhang W … Cao X (Biochemical and biophysical research communications 2000) 2 3 4 22 60
  2. Human JIK, a novel member of the STE20 kinase family that inhibits JNK and is negatively regulated by epidermal growth factor. (PMID: 10559204) Tassi E … Wong WT (The Journal of biological chemistry 1999) 2 3 4 22 60
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 45 60
  4. Signal transduction protein array analysis links LRRK2 to Ste20 kinases and PKC zeta that modulate neuronal plasticity. (PMID: 20949042) Zach S … Gillardon F (PloS one 2010) 3 4 60
  5. TAO kinases mediate activation of p38 in response to DNA damage. (PMID: 17396146) Raman M … Cobb MH (The EMBO journal 2007) 3 4 60

Products for TAOK3 Gene

  • Addgene plasmids for TAOK3

Sources for TAOK3 Gene

Content
Loading form....