Free for academic non-profit institutions. Other users need a Commercial license

Aliases for STK40 Gene

Aliases for STK40 Gene

  • Serine/Threonine Kinase 40 2 3 5
  • SINK-Homologous Serine/Threonine-Protein Kinase 3 4
  • Sugen Kinase 495 3 4
  • EC 2.7.11.1 4 58
  • SgK495 3 4
  • SHIK 3 4
  • Serine/Threonine-Protein Kinase 40 3
  • Ser/Thr-Like Kinase 3
  • EC 2.7.11 58

External Ids for STK40 Gene

Previous GeneCards Identifiers for STK40 Gene

  • GC01M036475
  • GC01M036577
  • GC01M036805
  • GC01M034921

Summaries for STK40 Gene

GeneCards Summary for STK40 Gene

STK40 (Serine/Threonine Kinase 40) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is TRIB3.

UniProtKB/Swiss-Prot for STK40 Gene

  • May be a negative regulator of NF-kappa-B and p53-mediated gene transcription.

Gene Wiki entry for STK40 Gene

Additional gene information for STK40 Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for STK40 Gene

Genomics for STK40 Gene

Regulatory Elements for STK40 Gene

Enhancers for STK40 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01H036370 2.1 FANTOM5 Ensembl ENCODE dbSUPER 25.9 +9.8 9847 10 HDGF PKNOX1 FOXA2 ARNT ZFP64 ARID4B SIN3A YBX1 FEZF1 DMAP1 CSF3R STK40 AGO3 LSM10 RNU4-27P SNORA63C OSCP1 ENSG00000223944 EVA1B LOC105378647
GH01H036087 1.5 FANTOM5 ENCODE 22.2 +296.7 296675 2 ZFP64 DMAP1 YY1 SLC30A9 ZNF143 SP3 NFYC ZC3H11A MEF2D ZNF610 SFPQ ZMYM4 AGO3 THRAP3 STK40 LOC105378647 TRAPPC3 COL8A2 AGO1 TEKT2
GH01H036148 1.8 FANTOM5 ENCODE dbSUPER 16.4 +235.1 235056 4 HDGF PKNOX1 ZFP64 ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 ZNF766 SFPQ MAP7D1 AGO3 STK40 ZMYM4 THRAP3 COL8A2 LOC105378647 EVA1B RPL5P4
GH01H036159 2 FANTOM5 Ensembl ENCODE dbSUPER 13.4 +222.2 222229 8 HDGF ARNT SIN3A FEZF1 ZNF2 YY1 ZNF766 ZNF143 SP3 REST CSF3R MAP7D1 AGO4 THRAP3 STK40 COL8A2 AGO3 AGO1 TRAPPC3 SH3D21
GH01H036463 1.2 ENCODE 22.2 -78.8 -78791 2 MLX ZFP64 YBX1 FEZF1 DMAP1 YY1 ZNF143 SP3 NFYC ZNF610 THRAP3 STK40 LOC105378647 TRAPPC3 OSCP1 COL8A2 AGO3 EVA1B MRPS15 CSF3R
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around STK40 on UCSC Golden Path with GeneCards custom track

Promoters for STK40 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000004803 127 2001 MLX FEZF1 DMAP1 YY1 ZNF143 SP3 NFYC ZC3H11A SSRP1 ZNF610

Genomic Location for STK40 Gene

Chromosome:
1
Start:
36,339,619 bp from pter
End:
36,385,927 bp from pter
Size:
46,309 bases
Orientation:
Minus strand

Genomic View for STK40 Gene

Genes around STK40 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
STK40 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for STK40 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for STK40 Gene

Proteins for STK40 Gene

  • Protein details for STK40 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8N2I9-STK40_HUMAN
    Recommended name:
    Serine/threonine-protein kinase 40
    Protein Accession:
    Q8N2I9
    Secondary Accessions:
    • D3DPS8
    • Q5VTK8
    • Q5VTK9
    • Q6ZMN1
    • Q8N2J8
    • Q8N3I6
    • Q96HN6
    • Q96I44
    • Q9BSA3
    • Q9H7H6

    Protein attributes for STK40 Gene

    Size:
    435 amino acids
    Molecular mass:
    49001 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAH08344.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAB15794.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAC11361.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for STK40 Gene

    Alternative splice isoforms for STK40 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for STK40 Gene

Selected DME Specific Peptides for STK40 Gene

Q8N2I9:
  • GVVHHHGLFQDR
  • TVCLIRKLLVLDPQQRL
  • RLSERET
  • IPEDGRVSE
  • AILAQRYL
  • PPVRRLG
  • ERETVVIFYDVVRVVEALH
  • HRDLKLGN
  • SQYEFENYMRQQLLLAEEK
  • QEERQGKMLLHTEYSLLSLLH
  • KRICLVLDCLCAHDFSDKTADLINLQHYVIKEKRL
  • IIASWQS
  • KNIVHRDLKLGNMVLNKRTHRIT
  • DLLKDQRGSPAYISPDVLSGRPYRGKPSDMWALGVVLF
  • LGPRLGNSPVPSIVQCLARKDGTDDFYQLKILTLEERG
  • LSGPLQVVPDIDDQ
  • IVHRDLK

Post-translational modifications for STK40 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for STK40 Gene

Domains & Families for STK40 Gene

Gene Families for STK40 Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted membrane proteins

Suggested Antigen Peptide Sequences for STK40 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q8N2I9

UniProtKB/Swiss-Prot:

STK40_HUMAN :
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
Family:
  • Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
genes like me logo Genes that share domains with STK40: view

Function for STK40 Gene

Molecular function for STK40 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot Function:
May be a negative regulator of NF-kappa-B and p53-mediated gene transcription.

Enzyme Numbers (IUBMB) for STK40 Gene

Phenotypes From GWAS Catalog for STK40 Gene

Gene Ontology (GO) - Molecular Function for STK40 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA --
GO:0005515 protein binding IPI 21784977
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with STK40: view
genes like me logo Genes that share phenotypes with STK40: view

Animal Models for STK40 Gene

MGI Knock Outs for STK40:

Animal Model Products

  • Taconic Biosciences Mouse Models for STK40

CRISPR Products

miRNA for STK40 Gene

miRTarBase miRNAs that target STK40

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for STK40
  • Applied Biological Materials Clones for STK40
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for STK40 Gene

Localization for STK40 Gene

Subcellular locations from UniProtKB/Swiss-Prot for STK40 Gene

Nucleus. Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for STK40 gene
Compartment Confidence
nucleus 5
cytosol 5
mitochondrion 2
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (3)
  • Nucleoplasm (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for STK40 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA --
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol IDA --
genes like me logo Genes that share ontologies with STK40: view

Pathways & Interactions for STK40 Gene

SuperPathways for STK40 Gene

No Data Available

Gene Ontology (GO) - Biological Process for STK40 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003016 respiratory system process IEA --
GO:0005977 glycogen metabolic process IEA --
GO:0006468 protein phosphorylation IEA --
GO:0010468 regulation of gene expression IEA --
GO:0016310 phosphorylation IEA --
genes like me logo Genes that share ontologies with STK40: view

No data available for Pathways by source and SIGNOR curated interactions for STK40 Gene

Drugs & Compounds for STK40 Gene

No Compound Related Data Available

Transcripts for STK40 Gene

Unigene Clusters for STK40 Gene

Serine/threonine kinase 40:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for STK40
  • Applied Biological Materials Clones for STK40
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for STK40 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4a · 4b ^ 5 ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10a · 10b · 10c ^ 11a · 11b ^ 12a · 12b · 12c · 12d · 12e ^ 13a · 13b ^ 14a · 14b ^ 15a ·
SP1: - - - - - - - - -
SP2: - - - - - - - - - -
SP3: - - -
SP4: - - - - - -
SP5: - - - -
SP6: - -
SP7: -
SP8: - - - - - - -
SP9: - - - - -
SP10: -
SP11:
SP12:
SP13: - - - - - - - - -
SP14:
SP15:

ExUns: 15b ^ 16a · 16b · 16c ^ 17 ^ 18a · 18b
SP1: -
SP2: -
SP3: -
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10: -
SP11: -
SP12:
SP13:
SP14:
SP15:

Relevant External Links for STK40 Gene

GeneLoc Exon Structure for
STK40
ECgene alternative splicing isoforms for
STK40

Expression for STK40 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for STK40 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for STK40 Gene

This gene is overexpressed in Whole Blood (x6.2).

Protein differential expression in normal tissues from HIPED for STK40 Gene

This gene is overexpressed in Monocytes (68.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for STK40 Gene



Protein tissue co-expression partners for STK40 Gene

NURSA nuclear receptor signaling pathways regulating expression of STK40 Gene:

STK40

SOURCE GeneReport for Unigene cluster for STK40 Gene:

Hs.471768

mRNA Expression by UniProt/SwissProt for STK40 Gene:

Q8N2I9-STK40_HUMAN
Tissue specificity: Strongly expressed in heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, liver, pancreas, testis, ovary, small intestine, colon and peripheral blood leukocytes.

Evidence on tissue expression from TISSUES for STK40 Gene

  • Nervous system(4.8)
  • Muscle(4.3)
  • Spleen(4.3)
  • Kidney(4.2)
  • Stomach(3.9)
genes like me logo Genes that share expression patterns with STK40: view

Primer Products

No data available for Phenotype-based relationships between genes and organs from Gene ORGANizer for STK40 Gene

Orthologs for STK40 Gene

This gene was present in the common ancestor of animals.

Orthologs for STK40 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia STK40 33 34
  • 99.16 (n)
oppossum
(Monodelphis domestica)
Mammalia STK40 34
  • 94 (a)
OneToOne
cow
(Bos Taurus)
Mammalia STK40 33 34
  • 91.19 (n)
dog
(Canis familiaris)
Mammalia STK40 33 34
  • 91.03 (n)
mouse
(Mus musculus)
Mammalia Stk40 33 16 34
  • 89.81 (n)
rat
(Rattus norvegicus)
Mammalia Stk40 33
  • 89.5 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia STK40 34
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves STK40 33 34
  • 81.69 (n)
lizard
(Anolis carolinensis)
Reptilia STK40 34
  • 86 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia stk40 33
  • 75.08 (n)
African clawed frog
(Xenopus laevis)
Amphibia LOC398681 33
zebrafish
(Danio rerio)
Actinopterygii stk40 33
  • 76.45 (n)
STK40 34
  • 73 (a)
OneToOne
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008948 33
  • 56.81 (n)
fruit fly
(Drosophila melanogaster)
Insecta trbl 34
  • 18 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea nipi-3 34
  • 9 (a)
OneToMany
Species where no ortholog for STK40 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for STK40 Gene

ENSEMBL:
Gene Tree for STK40 (if available)
TreeFam:
Gene Tree for STK40 (if available)

Paralogs for STK40 Gene

Paralogs for STK40 Gene

genes like me logo Genes that share paralogs with STK40: view

Variants for STK40 Gene

Sequence variations from dbSNP and Humsavar for STK40 Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs539738963 A colorectal adenocarcinoma sample 36,348,807(+) TTATC(C/T)GATGT reference, missense
rs755089893 A colorectal adenocarcinoma sample 36,355,378(+) TCTTC(A/G)TCTTC reference, missense
rs1000000046 -- 36,363,692(+) CCCCT(A/G)TAGTC intron-variant
rs1000126281 -- 36,340,985(+) AAGAG(A/C)CAGGT utr-variant-3-prime
rs1000132124 -- 36,377,467(+) GGCGG(A/T)GGTTG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for STK40 Gene

Variant ID Type Subtype PubMed ID
esv2676376 CNV deletion 23128226
esv2758931 CNV loss 17122850
esv3585734 CNV loss 21293372
nsv1145334 CNV deletion 24896259
nsv475537 CNV novel sequence insertion 20440878
nsv524394 CNV loss 19592680
nsv834702 CNV loss 17160897
nsv950610 CNV deletion 24416366

Variation tolerance for STK40 Gene

Residual Variation Intolerance Score: 10.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 7.95; 83.98% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for STK40 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
STK40

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for STK40 Gene

Disorders for STK40 Gene

Relevant External Links for STK40

Genetic Association Database (GAD)
STK40
Human Genome Epidemiology (HuGE) Navigator
STK40
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
STK40

No disorders were found for STK40 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for STK40 Gene

Publications for STK40 Gene

  1. Identification of a novel serine/threonine kinase that inhibits TNF-induced NF-kappaB activation and p53-induced transcription. (PMID: 13679039) Huang J … Shu HB (Biochemical and biophysical research communications 2003) 3 4 22 60
  2. The DNA sequence and biological annotation of human chromosome 1. (PMID: 16710414) Gregory SG … Prigmore E (Nature 2006) 3 4 60
  3. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 60
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 60
  5. Architecture of the human interactome defines protein communities and disease networks. (PMID: 28514442) Huttlin EL … Harper JW (Nature 2017) 3 60

Products for STK40 Gene

  • Addgene plasmids for STK40

Sources for STK40 Gene

Content
Loading form....