Aliases for ST8SIA1 Gene
Aliases for ST8SIA1 Gene
- ST8 Alpha-N-Acetyl-Neuraminide Alpha-2,8-Sialyltransferase 1 2 3 5
- Sialyltransferase 8 (Alpha-N-Acetylneuraminate: Alpha-2,8-Sialytransferase, GD3 Synthase) A 2 3
- ST8 Alpha-N-Acetylneuraminate Alpha-2,8-Sialyltransferase 1 2 3
- Alpha-2,8-Sialyltransferase 8A 3 4
- Sialyltransferase St8Sia I 3 4
- Ganglioside GD3 Synthase 3 4
- Ganglioside GT3 Synthase 3 4
- EC 2.4.99.8 4 56
- SIAT8-A 3 4
- ST8SiaI 3 4
- SIAT8A 3 4
- SIAT8 3 4
- Sialyltransferase 8A (Alpha-N-Acetylneuraminate: Alpha-2,8-Sialyltransferase, GD3 Synthase) 3
- Alpha-N-Acetylneuraminide Alpha-2,8-Sialyltransferase 3
- Ganglioside-Specific Alpha-2,8-Polysialyltransferase 3
- Disialoganglioside (GD3) Synthase 3
- Sialytransferase St8Sia I 3
- Sialyltransferase 8A 4
- ST8Sia I 2
- GD3S 3
External Ids for ST8SIA1 Gene
- HGNC: 10869
- Entrez Gene: 6489
- Ensembl: ENSG00000111728
- OMIM: 601123
- UniProtKB: Q92185
Previous HGNC Symbols for ST8SIA1 Gene
- SIAT8
- SIAT8A
Previous GeneCards Identifiers for ST8SIA1 Gene
- GC12M022246
- GC12M022119
Summaries for ST8SIA1 Gene
-
Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2015]
GeneCards Summary for ST8SIA1 Gene
ST8SIA1 (ST8 Alpha-N-Acetyl-Neuraminide Alpha-2,8-Sialyltransferase 1) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Transport to the Golgi and subsequent modification. Gene Ontology (GO) annotations related to this gene include sialyltransferase activity and alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity. An important paralog of this gene is ST8SIA5.
UniProtKB/Swiss-Prot for ST8SIA1 Gene
-
Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid.
Additional gene information for ST8SIA1 Gene
- Monarch Initiative
- Search for ST8SIA1 at DataMed
- Search for ST8SIA1 at HumanCyc
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ST8SIA1 Gene
Genomics for ST8SIA1 Gene
GeneHancer (GH) Regulatory Elements for ST8SIA1 Gene
GeneHancer (GH) Identifier | GH Type | GH Score |
GH Sources | Gene Association Score | Total Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites |
Gene Targets |
---|---|---|---|---|---|---|---|---|---|---|
GH12I022334 | Promoter/Enhancer | 1.8 | EPDnew Ensembl ENCODE | 550.1 | +101.7 | 101709 | 1.9 | FOXA2 ZSCAN4 BATF RAD21 ZNF335 GLIS2 ZNF143 ZNF391 RCOR1 BCLAF1 | LOC105369151 ST8SIA1 C2CD5 ENSG00000256714 | |
GH12I022436 | Enhancer | 0.6 | ENCODE dbSUPER | 550.8 | -0.2 | -152 | 1.7 | NFIC NFIB | ST8SIA1 C2CD5 ENSG00000256973 | |
GH12I022045 | Promoter/Enhancer | 2 | EPDnew Ensembl ENCODE | 9.7 | +389.5 | 389484 | 3.9 | ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 POLR2B ZNF143 KLF13 SP3 | CMAS ST8SIA1 LDHB LOC105369690 GC12M021918 | |
GH12I022041 | Enhancer | 1.1 | FANTOM5 Ensembl ENCODE | 9.6 | +393.9 | 393936 | 3.8 | SOX13 FOXA2 MAX YBX1 ZNF384 EGR1 FOS THAP11 SOX5 HLF | ST8SIA1 CMAS THEM4P1 GC12M021918 | |
GH12I022275 | Enhancer | 1.1 | FANTOM5 Ensembl ENCODE | 9.3 | +160.9 | 160927 | 1.9 | SMARCE1 RFX1 NEUROD1 DPF2 MNT ELF1 RFX5 SP1 CTBP1 GATA3 | ST8SIA1 LOC105369151 GC12M021918 |
Regulatory Element Products
Genomic Locations for ST8SIA1 Gene
- chr12:22,063,773-22,437,041
- (GRCh38/hg38)
- Size:
- 373,269 bases
- Orientation:
- Minus strand
- chr12:22,216,707-22,589,975
- (GRCh37/hg19)
Genomic View for ST8SIA1 Gene
- Cytogenetic band:
-
- 12p12.1 by Ensembl
- 12p12.1 by Entrez Gene
- 12p12.1 by HGNC


RefSeq DNA sequence for ST8SIA1 Gene
Proteins for ST8SIA1 Gene
-
Protein details for ST8SIA1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q92185-SIA8A_HUMAN
- Recommended name:
- Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
- Protein Accession:
- Q92185
- A8K4H6
- Q17RL0
- Q6PZN5
- Q93064
Protein attributes for ST8SIA1 Gene
- Size:
- 356 amino acids
- Molecular mass:
- 40519 Da
- Quaternary structure:
- No Data Available
- SequenceCaution:
-
- Sequence=AAC37586.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAA54891.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Protein Expression for ST8SIA1 Gene
Selected DME Specific Peptides for ST8SIA1 Gene
- Q92185:
-
- PSLRVYYTL
- WPFSVNM
- HAMPEEFLQLW
- LYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILK
- GKFWKSRGIH
- PISHHYYDNVLPF
Post-translational modifications for ST8SIA1 Gene
- Glycosylation at posLast=7171, isoforms=2119, posLast=214214, and isoforms=245
Other Protein References for ST8SIA1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1")
- Novus Biologicals Antibodies for ST8SIA1
-
Abcam antibodies for ST8SIA1
- Invitrogen Antibodies for ST8SIA1
- Search GeneTex for Antibodies for ST8SIA1
-
Santa Cruz Biotechnology (SCBT) Antibodies for ST8SIA1
Protein Products
- R&D Systems Proteins and Enzymes for ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1")
-
OriGene Purified Proteins for ST8SIA1
- Search Origene for MassSpec and Protein Over-expression Lysates for ST8SIA1
- Origene Custom Protein Services for ST8SIA1
- Sino Biological Recombinant Proteins for ST8SIA1
- Sino Biological Cell Lysates for ST8SIA1
- Search GeneTex for Proteins for ST8SIA1
-
ProSci Proteins for ST8SIA1
-
Abcam proteins for ST8SIA1
Assay Products
- antibodies-online: Search results for 1 available ST8SIA1 Elisa Kits ranked by validation data
- Compare Top ST8SIA1 Elisa Kits
-
Quality Products:
Domains & Families for ST8SIA1 Gene
Gene Families for ST8SIA1 Gene
- HGNC:
- Human Protein Atlas (HPA):
-
- Enzymes
- Predicted intracellular proteins
- Predicted membrane proteins
Protein Domains for ST8SIA1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for ST8SIA1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q92185- Family:
-
- Belongs to the glycosyltransferase 29 family.
Function for ST8SIA1 Gene
Molecular function for ST8SIA1 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- CMP-N-acetylneuraminate + alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-R = CMP + alpha-N-acetylneuraminyl-(2->8)-alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-R.
- UniProtKB/Swiss-Prot Function:
- Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid.
Enzyme Numbers (IUBMB) for ST8SIA1 Gene
Phenotypes From GWAS Catalog for ST8SIA1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0003828 | alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity | TAS,IEA | -- |
GO:0008373 | sialyltransferase activity | IEA,TAS | 8195250 |
GO:0016740 | transferase activity | IEA | -- |
GO:0016757 | transferase activity, transferring glycosyl groups | IEA | -- |
Phenotypes for ST8SIA1 Gene
- MGI mutant phenotypes for ST8SIA1:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for ST8SIA1:
-
- Increased vaccinia virus (VACV) infection
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased NF-kappaB reporter expression
- Negative genetic interaction between PTEN-/- and PTEN+/+
- Increased shRNA abundance (Z-score > 2)
- Increased G1 DNA content
- Negative genetic interaction between PTTG1-/- and PTTG1+/+
- Decreased infection with West Nile virus (WNV)
- Decreased West Nile virus (WNV) infection
- Decreased shRNA abundance (Z-score < -2)
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for ST8SIA1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for ST8SIA1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
- Search ViGene Biosciences for ST8SIA1
CRISPR Products
-
OriGene CRISPR knockouts for ST8SIA1
- genomics-online: gRNA clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
- Applied Biological Materials CRISPR for ST8SIA1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for ST8SIA1
- GenScript: Design CRISPR guide RNA sequences for ST8SIA1
miRNA for ST8SIA1 Gene
- miRTarBase miRNAs that target ST8SIA1
-
- mmu-mir-3572-3p (MIRT580706)
- mmu-mir-741-3p (MIRT593014)
- mmu-mir-466l-5p (MIRT593136)
- mmu-mir-466i-5p (MIRT593137)
- mmu-mir-466d-5p (MIRT593138)
- mmu-mir-466k (MIRT593139)
- mmu-mir-376c-3p (MIRT593140)
- mmu-mir-1943-5p (MIRT602969)
- mmu-mir-882 (MIRT602970)
- mmu-mir-3473a (MIRT602971)
- mmu-mir-185-5p (MIRT602972)
- mmu-mir-466o-3p (MIRT606741)
- mmu-mir-466m-3p (MIRT606742)
- mmu-mir-466n-3p (MIRT606743)
miRNA Products
- Search ViGene Biosciences for ST8SIA1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for ST8SIA1
- Browse OriGene Inhibitory RNA Products For ST8SIA1
- genomics-online: shRNA clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
Clone Products
- Sino Biological Human cDNA Clone for ST8SIA1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for ST8SIA1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ST8SIA1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for ST8SIA1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
Cell Line Products
-
Horizon Cell Lines for ST8SIA1
-
ViGene Biosciences adenoviral particle packaged cDNA for ST8SIA1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for ST8SIA1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ST8SIA1 Gene
Localization for ST8SIA1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ST8SIA1 Gene
- Golgi apparatus membrane; Single-pass type II membrane protein.
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0000139 | Golgi membrane | TAS | -- |
GO:0005794 | Golgi apparatus | IEA | -- |
GO:0016020 | membrane | IEA | -- |
GO:0016021 | integral component of membrane | IEA | -- |
No data available for Subcellular locations from the Human Protein Atlas (HPA) for ST8SIA1 Gene
Pathways & Interactions for ST8SIA1 Gene
Pathways by source for ST8SIA1 Gene
2 BioSystems pathways for ST8SIA1 Gene
UniProtKB/Swiss-Prot Q92185-SIA8A_HUMAN
- Pathway: Lipid metabolism; sphingolipid metabolism.
- Pathway: Protein modification; protein glycosylation.
Interacting Proteins for ST8SIA1 Gene
GO ID | Qualified GO term | Evidence | PubMed IDs |
---|---|---|---|
GO:0005975 | carbohydrate metabolic process | TAS | 8195250 |
GO:0006486 | protein glycosylation | IEA | -- |
GO:0006629 | lipid metabolic process | IEA | -- |
GO:0006665 | sphingolipid metabolic process | IEA | -- |
GO:0006688 | glycosphingolipid biosynthetic process | TAS | 8195250 |
No data available for SIGNOR curated interactions for ST8SIA1 Gene
Drugs & Compounds for ST8SIA1 Gene
Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
---|---|---|---|---|---|---|
Cytidine monophosphate | Experimental | Pharma | 0 |
Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
---|---|---|---|---|---|---|
Cytidine monophosphate N-acetylneuraminic acid |
|
22-12-8 |
|
|||
Ganglioside GD3 (d18:1/12:0) |
|
104443-61-0 |
|
|||
Ganglioside GD3 (d18:1/16:0) |
|
104443-61-0 |
|
|||
Ganglioside GD3 (d18:1/20:0) |
|
104443-61-0 |
|
|||
Ganglioside GD3 (d18:1/24:0) |
|
104443-61-0 |
|
Transcripts for ST8SIA1 Gene
mRNA/cDNA for ST8SIA1 Gene
- (2) REFSEQ mRNAs :
- (14) Additional mRNA sequences :
- (61) Selected AceView cDNA sequences:
- (15) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for ST8SIA1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for ST8SIA1
- genomics-online: gRNA clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
- Applied Biological Materials CRISPR for ST8SIA1
-
Vectors and viruses for KO, Activation, Repression, and more
-
Santa Cruz Biotechnology (SCBT) CRISPR for ST8SIA1
- GenScript: Design CRISPR guide RNA sequences for ST8SIA1
miRNA Products
- Search ViGene Biosciences for ST8SIA1
Inhibitory RNA Products
- Origene RNAi, sirna, and shrna products in human, mouse, rat for ST8SIA1
- Browse OriGene Inhibitory RNA Products For ST8SIA1
- genomics-online: shRNA clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
-
ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
Clone Products
- Sino Biological Human cDNA Clone for ST8SIA1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for ST8SIA1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ST8SIA1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- Applied Biological Materials Clones for ST8SIA1
-
Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more
ExUns: | 1a | · | 1b | · | 1c | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | · | 7c | · | 7d |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SP1: | - | - | - | ||||||||||||||||||||||
SP2: | - | - | - | - | |||||||||||||||||||||
SP3: | |||||||||||||||||||||||||
SP4: | - | ||||||||||||||||||||||||
SP5: |
Expression for ST8SIA1 Gene
mRNA differential expression in normal tissues according to GTEx for ST8SIA1 Gene
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for ST8SIA1 Gene
NURSA nuclear receptor signaling pathways regulating expression of ST8SIA1 Gene:
ST8SIA1SOURCE GeneReport for Unigene cluster for ST8SIA1 Gene:
Hs.408614mRNA Expression by UniProt/SwissProt for ST8SIA1 Gene:
Q92185-SIA8A_HUMANEvidence on tissue expression from TISSUES for ST8SIA1 Gene
- Intestine(4.2)
- Stomach(4.1)
- Nervous system(2.1)
Primer Products
-
OriGene qPCR primer pairs for ST8SIA1
- genomics-online: primer clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for ST8SIA1 Gene
Orthologs for ST8SIA1 Gene
This gene was present in the common ancestor of chordates.
Organism | Taxonomy | Gene | Similarity | Type | Details |
---|---|---|---|---|---|
chimpanzee (Pan troglodytes) |
Mammalia | ST8SIA1 33 34 |
|
||
dog (Canis familiaris) |
Mammalia | ST8SIA1 33 34 |
|
||
cow (Bos Taurus) |
Mammalia | ST8SIA1 33 34 |
|
||
mouse (Mus musculus) |
Mammalia | St8sia1 33 16 34 |
|
||
rat (Rattus norvegicus) |
Mammalia | St8sia1 33 |
|
||
oppossum (Monodelphis domestica) |
Mammalia | ST8SIA1 34 |
|
OneToOne | |
chicken (Gallus gallus) |
Aves | ST8SIA1 33 34 |
|
||
lizard (Anolis carolinensis) |
Reptilia | ST8SIA1 34 |
|
OneToOne | |
African clawed frog (Xenopus laevis) |
Amphibia | LOC398735 33 |
|
||
zebrafish (Danio rerio) |
Actinopterygii | LOC100333872 33 |
|
||
st8sia1 34 34 |
|
OneToMany |
- Species where no ortholog for ST8SIA1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- fruit fly (Drosophila melanogaster)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- platypus (Ornithorhynchus anatinus)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- tropical clawed frog (Silurana tropicalis)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for ST8SIA1 Gene
(8) SIMAP similar genes for ST8SIA1 Gene using alignment to 7 proteins:
Variants for ST8SIA1 Gene
SNP ID | Clin | Chr 12 pos | Variation | AA Info | Type |
---|---|---|---|---|---|
rs1000023645 | -- | 22,195,271(-) | C/G | 3_prime_UTR_variant | |
rs1000040919 | -- | 22,324,748(-) | C/T | intron_variant | |
rs1000059726 | -- | 22,282,560(-) | G/T | intron_variant | |
rs1000101399 | -- | 22,317,108(-) | T/C | intron_variant | |
rs1000117589 | -- | 22,218,420(-) | C/A | intron_variant |
Variant ID | Type | Subtype | PubMed ID |
---|---|---|---|
dgv467e212 | CNV | loss | 25503493 |
esv23565 | CNV | loss | 19812545 |
esv2759883 | CNV | gain+loss | 17122850 |
esv3304736 | CNV | mobile element insertion | 20981092 |
esv33913 | CNV | gain | 17666407 |
esv3435731 | CNV | insertion | 20981092 |
esv3580188 | CNV | loss | 25503493 |
nsv1070516 | CNV | deletion | 25765185 |
nsv1119938 | CNV | deletion | 24896259 |
nsv1119939 | CNV | deletion | 24896259 |
nsv1130908 | CNV | deletion | 24896259 |
nsv1146956 | CNV | deletion | 26484159 |
nsv435637 | CNV | deletion | 17901297 |
nsv476720 | CNV | novel sequence insertion | 20440878 |
nsv482978 | CNV | loss | 15286789 |
nsv521274 | CNV | loss | 19592680 |
Additional Variant Information for ST8SIA1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- ST8SIA1
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ST8SIA1 Gene
Disorders for ST8SIA1 Gene
Additional Disease Information for ST8SIA1
- Genetic Association Database
- (GAD)
- Human Genome Epidemiology Navigator
- (HuGE)
- ATLAS of Genetics and Cytogenetics in Oncology and Haematology
No disorders were found for ST8SIA1 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ST8SIA1 Gene
Publications for ST8SIA1 Gene
- Variants in ST8SIA1 do not play a major role in susceptibility to multiple sclerosis in Canadian families. (PMID: 19428123) Ramagopalan SV … Ebers GC (Journal of neuroimmunology 2009) 3 22 44 58
- Variants of ST8SIA1 are associated with risk of developing multiple sclerosis. (PMID: 18612409) Husain S … Vitale E (PloS one 2008) 3 22 44 58
- Isolation of GD3 synthase gene by expression cloning of GM3 alpha-2,8-sialyltransferase cDNA using anti-GD2 monoclonal antibody. (PMID: 7937974) Haraguchi M … Furukawa K (Proceedings of the National Academy of Sciences of the United States of America 1994) 3 4 22 58
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 44 58
- Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease. (PMID: 20708005) Chalasani N … Nonalcoholic Steatohepatitis Clinical Research Network (Gastroenterology 2010) 3 44 58
Products for ST8SIA1 Gene
- R&D Systems Antibodies for ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1")
- R&D Systems Proteins and Enzymes for ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1")
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Browse OriGene Antibodies
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for ST8SIA1
- Search Origene for MassSpec and Protein Over-expression Lysates for ST8SIA1
- Origene Custom Protein Services for ST8SIA1
- Origene shrna, sirna, and RNAi products in human, mouse, rat for ST8SIA1
- Browse OriGene Inhibitory RNA Products For ST8SIA1
- OriGene qPCR primer pairs for ST8SIA1
- OriGene CRISPR knockouts for ST8SIA1
- OriGene ORF clones in human for ST8SIA1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ST8SIA1
- GenScript: Next-day shipping of latest version cDNA ORF clones for ST8SIA1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for ST8SIA1
- GenScript Custom Assay Services for ST8SIA1
- GenScript Custom overexpressing Cell Line Services for ST8SIA1
- GenScript: Design CRISPR guide RNA sequences for ST8SIA1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for ST8SIA1
- Sino Biological Human cDNA Clone for ST8SIA1
- Sino Biological Cell Lysates for ST8SIA1
- Sino Biological Recombinant Proteins for ST8SIA1
- Browse Sino Biological Antibodies
- Browse Sino Biological Assays
- Browse Sino Biological ELISA Kits
- Browse Sino Biological ELISA Pair Sets
- Browse Sino Biological CRO Services
- Browse Sino Biological Control Vectors
- Sino Biological Transfection Reagent
- Sino Biological Anti-His Tag Antibody
- Novus Biologicals Antibodies for ST8SIA1
- Novus Biologicals proteins and lysates for ST8SIA1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Abcam antibodies for ST8SIA1
- Abcam proteins for ST8SIA1
- Find your target
- Browse Primary Antibodies
- Browse Conjugated Primary Antibodies
- Browse Secondary Antibodies
- Browse ELISA Kits
- Browse Matched Antibody Pairs
- Browse Proteins and Peptides
- Search Knockout (KO) Validated Antibodies
- Browse Monoclonal Antibodies
- Browse Recombinant Antibodies
- Browse Antibodies at Cloud-Clone Corp.
- Browse Proteins at Cloud-Clone Corp.
- Browse Assay Kits at Cloud-Clone Corp.
- Browse Knockouts at Cloud-Clone Corp.
- Browse Knockins at Cloud-Clone Corp.
- Cloud-Clone Corp. disease models service
- Browse cDNA clones at Cloud-Clone Corp.
- Browse primers at Cloud-Clone Corp.
- Cloud-Clone Corp. primary cells service
- Invitrogen Antibodies for ST8SIA1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- Cyagen custom Knockout/knockin (KOKI) mouse models for ST8SIA1
- VectorBuilder custom plasmid, inducible vectors for ST8SIA1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ST8SIA1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
- antibodies-online: Search results for 9 available ST8SIA1 Antibodies ranked by validation data
- Compare Top ST8SIA1 Antibodies
- Quality Products:
- antibodies-online: Search results for 1 available ST8SIA1 Elisa Kits ranked by validation data
- Compare Top ST8SIA1 Elisa Kits
- Quality Products:
- antibodies-online: Search results for 9 available ST8SIA1 Proteins ranked by validation data
- Compare Top ST8SIA1 Proteins
- Quality Products:
- Search GeneTex for Antibodies for ST8SIA1
- Search GeneTex for Proteins for ST8SIA1
- ViGene Biosciences adenoviral particle packaged cDNA for ST8SIA1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for ST8SIA1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
- Search ViGene Biosciences for ST8SIA1
- Santa Cruz Biotechnology (SCBT) Antibodies for ST8SIA1
- Search Santa Cruz Biotechnology (SCBT) for ST8SIA1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for ST8SIA1
- Horizon Cell Lines for ST8SIA1
- genomics-online: cdna clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
- orf clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
- genomics-online: gRNA clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
- genomics-online: primer clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
- genomics-online: shRNA clones - Search results for 110 available ST8SIA1 gene related products
- Overview of 110 available ST8SIA1 gene related products
Sources for ST8SIA1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) ASD
- (29) ECgene
- (30) GeneAnnot
- (31) CGAP SAGE
- (32) SOURCE
- (33) HomoloGene
- (34) PanEnsembl
- (35) euGenes
- (36) SGD
- (37) FlyBase
- (38) WormBase
- (39) Pseudogene
- (40) DGV
- (41) dbSNP
- (42) GenAtlas
- (43) HGMD
- (44) GAD
- (45) BGMUT
- (46) HuGE
- (47) Atlas
- (48) Cell Signaling Technology
- (49) GenBank
- (50) H-invDB
- (51) HORDE
- (52) HUGE
- (53) IMGT
- (54) Leiden
- (55) miRBase
- (56) DME
- (57) OriGene
- (58) PubMed
- (59) R&D Systems
- (60) TGDB
- (61) Tocris
- (62) Abcam
- (63) Novus Biologicals
- (64) ProSpec
- (65) Sino Biological
- (66) GenScript
- (67) Qiagen
- (68) Cloud-Clone Corp.
- (69) OCA
- (70) Proteopedia
- (71) MOPED
- (72) neXtProt
- (73) Reactome
- (74) GeneGo (Thomson Reuters)
- (75) fRNAdb
- (76) DISEASES
- (77) SIMAP
- (78) GenomeRNAi
- (79) LifeMap
- (80) miRTarBase
- (81) MalaCards
- (82) Invitrogen
- (83) BitterDB
- (84) Vector BioLabs
- (85) ESI-BIO
- (86) RefSeq
- (87) BioSystems
- (88) MaxQB
- (89) IUPHAR
- (90) BioGPS
- (91) Illumina
- (92) COMPARTMENTS
- (93) HOMER
- (94) PaxDb
- (95) ApexBio
- (96) Addgene
- (97) antibodies-online
- (98) CYP
- (99) NONCODE
- (100) SwitchGear Genomics
- (101) TreeFam
- (102) PathCards
- (103) GeneReviews
- (104) GeneTex
- (105) Taconic Biosciences
- (106) GTEx
- (107) ProteomicsDB
- (108) SCBT
- (109) DGIdb
- (110) ClinicalTrials
- (111) FDA Approved Drugs
- (112) RVIS
- (113) SIGNOR
- (114) diseasecard
- (115) NIH Rare Diseases
- (116) Orphanet
- (117) UMLS
- (118) GTR
- (119) Disease Ontology
- (120) Genetics Home Reference
- (121) MeSH
- (122) MedlinePlus
- (123) CDC
- (124) NINDS
- (125) NCBI Bookshelf
- (126) ClinVar
- (127) Gene Damage Index
- (128) ViGene Biosciences
- (129) HPO
- (130) UDN
- (131) VISTA
- (132) FANTOM5
- (133) ENCODE
- (134) ProSci
- (135) Horizon
- (136) NURSA
- (137) IID
- (138) Cyagen
- (139) VectorBuilder
- (140) SNPedia
- (141) BRCA Exchange
- (142) St John's Lab
- (143) CIViC
- (144) ProteoGenix
- (145) dbSUPER
- (146) TISSUES
- (147) Gene ORGANizer
- (148) abm
- (149) CrownBio
- (150) Human Protein Atlas
- (151) GWAS Catalog
- (152) Monarch Initiative
- (153) DataMed
- (154) HumanCyc
- (155) genomics-online
- (156) UCNEbase
- (157) EPDnew