Aliases for ST8SIA1 Gene
Aliases for ST8SIA1 Gene
- ST8 Alpha-N-Acetyl-Neuraminide Alpha-2,8-Sialyltransferase 1 2 3 5
- Sialyltransferase 8 (Alpha-N-Acetylneuraminate: Alpha-2,8-Sialytransferase, GD3 Synthase) A 2 3
- ST8 Alpha-N-Acetylneuraminate Alpha-2,8-Sialyltransferase 1 2 3
- Alpha-2,8-Sialyltransferase 8A 3 4
- Sialyltransferase St8Sia I 3 4
- Ganglioside GD3 Synthase 3 4
- Ganglioside GT3 Synthase 3 4
- EC 2.4.99.8 4 61
- SIAT8-A 3 4
- ST8SiaI 3 4
- SIAT8A 3 4
- SIAT8 3 4
- Sialyltransferase 8A (Alpha-N-Acetylneuraminate: Alpha-2,8-Sialyltransferase, GD3 Synthase) 3
- Alpha-N-Acetylneuraminide Alpha-2,8-Sialyltransferase 3
- Ganglioside-Specific Alpha-2,8-Polysialyltransferase 3
- Disialoganglioside (GD3) Synthase 3
- Sialytransferase St8Sia I 3
- Sialyltransferase 8A 4
- ST8Sia I 2
- GD3S 3
External Ids for ST8SIA1 Gene
- HGNC: 10869
- Entrez Gene: 6489
- Ensembl: ENSG00000111728
- OMIM: 601123
- UniProtKB: Q92185
Previous HGNC Symbols for ST8SIA1 Gene
- SIAT8
- SIAT8A
Previous GeneCards Identifiers for ST8SIA1 Gene
- GC12M022246
- GC12M022119
Summaries for ST8SIA1 Gene
-
Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2015]
GeneCards Summary for ST8SIA1 Gene
ST8SIA1 (ST8 Alpha-N-Acetyl-Neuraminide Alpha-2,8-Sialyltransferase 1) is a Protein Coding gene. Among its related pathways are Synthesis of substrates in N-glycan biosythesis and Glycosphingolipid biosynthesis - ganglio series. GO annotations related to this gene include sialyltransferase activity and alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity. An important paralog of this gene is ST8SIA6.
UniProtKB/Swiss-Prot for ST8SIA1 Gene
-
Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid.
No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ST8SIA1 Gene
Genomics for ST8SIA1 Gene
Regulatory Elements for ST8SIA1 Gene
Enhancers for ST8SIA1 Gene
| GeneHancer Identifier | Enhancer Score | Enhancer Sources | Gene-Enhancer Score | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites within enhancer | Gene Targets for Enhancer |
|---|---|---|---|---|---|---|---|---|
| GH12G022041 | 1.3 | FANTOM5 Ensembl ENCODE | 9.6 | +393.9 | 393936 | 3.8 | SOX13 MAX YBX1 ZNF384 EGR1 FOS NFE2L2 THAP11 SOX5 HLF | ST8SIA1 CMAS THEM4P1 |
| GH12G022281 | 1.1 | FANTOM5 Ensembl ENCODE | 10.6 | +154.2 | 154231 | 2.4 | JUND GATA2 JUN BHLHE40 FOS | ST8SIA1 LOC105369151 GC12M021918 |
| GH12G022275 | 1.2 | FANTOM5 Ensembl ENCODE | 9.3 | +160.9 | 160928 | 1.9 | RFX1 MNT DPF2 JUND GATA3 CTBP1 ZBTB33 FOS FOSL2 | ST8SIA1 LOC105369151 GC12M021918 |
| GH12G022045 | 1 | ENCODE | 9.7 | +389.5 | 389485 | 3.9 | ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 ZNF143 SP3 SP5 REST | ST8SIA1 LDHB CMAS LOC105369690 |
| GH12G022285 | 1 | FANTOM5 Ensembl ENCODE | 7 | +149.8 | 149817 | 2.8 | RBBP5 FOS MAFK | ST8SIA1 C2CD5 LOC105369151 GC12M021918 |
- Elite enhancer and/or Elite enhancer-gene association
Download GeneHancer data dump
Enhancers around ST8SIA1 on UCSC Golden Path with GeneCards custom track
- Transcription factor binding sites by QIAGEN in the ST8SIA1 gene promoter:
Regulatory Element Products
Genomic Location for ST8SIA1 Gene
- Chromosome:
- 12
- Start:
- 22,063,773 bp from pter
- End:
- 22,437,041 bp from pter
- Size:
- 373,269 bases
- Orientation:
- Minus strand
Genomic View for ST8SIA1 Gene
Genes around ST8SIA1 on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 12p12.1 by Ensembl
- 12p12.1 by Entrez Gene
- 12p12.1 by HGNC
ST8SIA1 Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for ST8SIA1 Gene
Proteins for ST8SIA1 Gene
-
Protein details for ST8SIA1 Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- Q92185-SIA8A_HUMAN
- Recommended name:
- Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
- Protein Accession:
- Q92185
- A8K4H6
- Q17RL0
- Q6PZN5
- Q93064
Protein attributes for ST8SIA1 Gene
- Size:
- 356 amino acids
- Molecular mass:
- 40519 Da
- Quaternary structure:
- No Data Available
- SequenceCaution:
-
- Sequence=AAC37586.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAA54891.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Protein Expression for ST8SIA1 Gene
Selected DME Specific Peptides for ST8SIA1 Gene
- Q92185:
-
- PSLRVYYTL
- WPFSVNM
- HAMPEEFLQLW
- LYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILK
- GKFWKSRGIH
- PISHHYYDNVLPF
Post-translational modifications for ST8SIA1 Gene
Other Protein References for ST8SIA1 Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- R&D Systems Antibodies for ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1")
- Novus Biologicals Antibodies for ST8SIA1
- Invitrogen Antibodies for ST8SIA1
- antibodies-online Antibodies for ST8SIA1: See all 7
- GeneTex ST8SIA1 antibody for ST8SIA1
-
Santa Cruz Biotechnology (SCBT) Antibodies for ST8SIA1
Protein Products
- R&D Systems Proteins and Enzymes for ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1")
-
OriGene Purified Proteins for ST8SIA1
- Search Origene for MassSpec and Protein Over-expression Lysates for ST8SIA1
- Origene Custom Protein Services for ST8SIA1
- Sino Biological Cell Lysates for ST8SIA1
- Sino Biological Recombinant Proteins for ST8SIA1
- antibodies-online Proteins for ST8SIA1: See all 6
- Search antibodies-online for peptides
- Search GeneTex for Proteins for ST8SIA1
-
ProSci Proteins for ST8SIA1
Assay Products
- antibodies-online Kits for ST8SIA1: See all 1
Domains & Families for ST8SIA1 Gene
Gene Families for ST8SIA1 Gene
- HGNC:
Protein Domains for ST8SIA1 Gene
- InterPro:
- Blocks:
- ProtoNet:
Suggested Antigen Peptide Sequences for ST8SIA1 Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
Q92185- Family:
-
- Belongs to the glycosyltransferase 29 family.
Function for ST8SIA1 Gene
Molecular function for ST8SIA1 Gene
- UniProtKB/Swiss-Prot CatalyticActivity:
- CMP-N-acetylneuraminate + alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-R = CMP + alpha-N-acetylneuraminyl-(2->8)-alpha-N-acetylneuraminyl-(2->3)-beta-D-galactosyl-R.
- UniProtKB/Swiss-Prot Function:
- Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid.
Enzyme Numbers (IUBMB) for ST8SIA1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0003828 | alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity | TAS | -- |
| GO:0008373 | sialyltransferase activity | IEA,TAS | 8195250 |
| GO:0016740 | transferase activity | IEA | -- |
| GO:0016757 | transferase activity, transferring glycosyl groups | IEA | -- |
Phenotypes for ST8SIA1 Gene
- MGI mutant phenotypes for ST8SIA1:
- inferred from 2 alleles
- GenomeRNAi human phenotypes for ST8SIA1:
-
- Increased vaccinia virus (VACV) infection
- Mildly decreased CFP-tsO45G cell surface transport
- Decreased NF-kappaB reporter expression
- Negative genetic interaction between PTEN-/- and PTEN+/+
- Increased shRNA abundance (Z-score > 2)
- Increased G1 DNA content
- Negative genetic interaction between PTTG1-/- and PTTG1+/+
- Decreased infection with West Nile virus (WNV)
- Decreased West Nile virus (WNV) infection
- Decreased shRNA abundance (Z-score < -2)
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
- Cyagen custom Knockout/knockin (KOKI) mouse models for ST8SIA1
-
-
ViGene Biosciences lentiviral particle packaged cDNA for ST8SIA1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
- Search ViGene Biosciences for ST8SIA1
CRISPR Products
-
OriGene CRISPR knockouts for ST8SIA1
-
Santa Cruz Biotechnology (SCBT) CRISPR for ST8SIA1
- GenScript: Design CRISPR guide RNA sequences for ST8SIA1
miRNA for ST8SIA1 Gene
- miRTarBase miRNAs that target ST8SIA1
-
- mmu-mir-3572-3p (MIRT580706)
- mmu-mir-741-3p (MIRT593014)
- mmu-mir-466l-5p (MIRT593136)
- mmu-mir-466i-5p (MIRT593137)
- mmu-mir-466d-5p (MIRT593138)
- mmu-mir-466k (MIRT593139)
- mmu-mir-376c-3p (MIRT593140)
- mmu-mir-1943-5p (MIRT602969)
- mmu-mir-882 (MIRT602970)
- mmu-mir-3473a (MIRT602971)
- mmu-mir-185-5p (MIRT602972)
- mmu-mir-466o-3p (MIRT606741)
- mmu-mir-466m-3p (MIRT606742)
- mmu-mir-466n-3p (MIRT606743)
miRNA Products
- Search ViGene Biosciences for ST8SIA1
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for ST8SIA1
- Browse OriGene Inhibitory RNA Products For ST8SIA1
-
ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
Clone Products
-
OriGene ORF clones in human for ST8SIA1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for ST8SIA1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for ST8SIA1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ST8SIA1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Cell Line Products
-
Horizon Cell Lines for ST8SIA1
-
ViGene Biosciences adenoviral particle packaged cDNA for ST8SIA1 gene
-
ViGene Biosciences lentiviral particle packaged cDNA for ST8SIA1 gene
-
ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ST8SIA1 Gene
Localization for ST8SIA1 Gene
Subcellular locations from UniProtKB/Swiss-Prot for ST8SIA1 Gene
- Golgi apparatus membrane; Single-pass type II membrane protein.
| Compartment | Confidence |
|---|---|
| golgi apparatus | 5 |
| mitochondrion | 2 |
| plasma membrane | 1 |
| extracellular | 1 |
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0000139 | Golgi membrane | TAS | -- |
| GO:0005794 | Golgi apparatus | IEA | -- |
| GO:0016020 | membrane | IEA | -- |
| GO:0016021 | integral component of membrane | IEA | -- |
| GO:0030173 | integral component of Golgi membrane | IEA | -- |
Pathways & Interactions for ST8SIA1 Gene
Pathways by source for ST8SIA1 Gene
2 BioSystems pathways for ST8SIA1 Gene
UniProtKB/Swiss-Prot Q92185-SIA8A_HUMAN
- Pathway: Lipid metabolism; sphingolipid metabolism.
- Pathway: Protein modification; protein glycosylation.
Interacting Proteins for ST8SIA1 Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0005975 | carbohydrate metabolic process | TAS | 8195250 |
| GO:0006486 | protein glycosylation | IEA | -- |
| GO:0006629 | lipid metabolic process | IEA | -- |
| GO:0006665 | sphingolipid metabolic process | IEA | -- |
| GO:0006688 | glycosphingolipid biosynthetic process | TAS | 8195250 |
No data available for SIGNOR curated interactions for ST8SIA1 Gene
Drugs & Compounds for ST8SIA1 Gene
| Name | Status | Disease Links | Group | Role | Mechanism of Action | Clinical Trials |
|---|---|---|---|---|---|---|
| Cytidine monophosphate | Experimental | Pharma | 0 |
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| Cytidine monophosphate N-acetylneuraminic acid |
|
22-12-8 |
|
|||
| Ganglioside GD3 (d18:1/12:0) |
|
104443-61-0 |
|
|||
| Ganglioside GD3 (d18:1/16:0) |
|
104443-61-0 |
|
|||
| Ganglioside GD3 (d18:1/20:0) |
|
104443-61-0 |
|
|||
| Ganglioside GD3 (d18:1/24:0) |
|
104443-61-0 |
|
Transcripts for ST8SIA1 Gene
mRNA/cDNA for ST8SIA1 Gene
- (2) REFSEQ mRNAs :
- (14) Additional mRNA sequences :
- (61) Selected AceView cDNA sequences:
- (15) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for ST8SIA1 Gene
CRISPR Products
-
OriGene CRISPR knockouts for ST8SIA1
-
Santa Cruz Biotechnology (SCBT) CRISPR for ST8SIA1
- GenScript: Design CRISPR guide RNA sequences for ST8SIA1
miRNA Products
- Search ViGene Biosciences for ST8SIA1
Inhibitory RNA Products
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for ST8SIA1
- Browse OriGene Inhibitory RNA Products For ST8SIA1
-
ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
Clone Products
-
OriGene ORF clones in human for ST8SIA1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Sino Biological Human cDNA Clone for ST8SIA1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- VectorBuilder custom plasmid, inducible vectors for ST8SIA1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ST8SIA1
-
VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
| ExUns: | 1a | · | 1b | · | 1c | ^ | 2 | ^ | 3 | ^ | 4a | · | 4b | ^ | 5 | ^ | 6 | ^ | 7a | · | 7b | · | 7c | · | 7d |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | - | - | ||||||||||||||||||||||
| SP2: | - | - | - | - | |||||||||||||||||||||
| SP3: | |||||||||||||||||||||||||
| SP4: | - | ||||||||||||||||||||||||
| SP5: |
Expression for ST8SIA1 Gene
mRNA differential expression in normal tissues according to GTEx for ST8SIA1 Gene
This gene is overexpressed in Brain - Cerebellum (x4.0) and Brain - Cerebellar Hemisphere (x4.0).
This gene is overexpressed in Plasma (42.0) and Heart (27.0).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for ST8SIA1 Gene
- Elite partner
NURSA nuclear receptor signaling pathways regulating expression of ST8SIA1 Gene:
ST8SIA1SOURCE GeneReport for Unigene cluster for ST8SIA1 Gene:
Hs.408614mRNA Expression by UniProt/SwissProt for ST8SIA1 Gene:
Q92185-SIA8A_HUMAN
Tissue specificity:
Strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung.
Evidence on tissue expression from TISSUES for ST8SIA1 Gene
- Intestine(4.2)
- Stomach(4.1)
- Nervous system(2)
Primer Products
-
OriGene qPCR primer pairs for ST8SIA1
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and Phenotype-based relationships between genes and organs from Gene ORGANizer for ST8SIA1 Gene
Orthologs for ST8SIA1 Gene
This gene was present in the common ancestor of chordates.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| chimpanzee (Pan troglodytes) |
Mammalia | ST8SIA1 34 35 |
|
||
| dog (Canis familiaris) |
Mammalia | ST8SIA1 34 35 |
|
||
| cow (Bos Taurus) |
Mammalia | ST8SIA1 34 35 |
|
||
| mouse (Mus musculus) |
Mammalia | St8sia1 34 16 35 |
|
||
| rat (Rattus norvegicus) |
Mammalia | St8sia1 34 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | ST8SIA1 35 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | ST8SIA1 34 35 |
|
||
| lizard (Anolis carolinensis) |
Reptilia | ST8SIA1 35 |
|
OneToOne | |
| African clawed frog (Xenopus laevis) |
Amphibia | LOC398735 34 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | LOC100333872 34 |
|
||
| st8sia1 35 35 |
|
OneToMany |
- Species where no ortholog for ST8SIA1 was found in the sources mined by GeneCards:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- fruit fly (Drosophila melanogaster)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- platypus (Ornithorhynchus anatinus)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea squirt (Ciona intestinalis)
- sea squirt (Ciona savignyi)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- tropical clawed frog (Silurana tropicalis)
- wheat (Triticum aestivum)
- worm (Caenorhabditis elegans)
Paralogs for ST8SIA1 Gene
(8) SIMAP similar genes for ST8SIA1 Gene using alignment to 7 proteins:
Variants for ST8SIA1 Gene
| SNP ID | Clin | Chr 12 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs1000023645 | -- | 22,195,271(+) | AACTC(C/G)CAGGA | utr-variant-3-prime | |
| rs1000040919 | -- | 22,324,748(+) | ATGCT(C/T)AGCTA | intron-variant, nc-transcript-variant | |
| rs1000059726 | -- | 22,282,560(+) | TCCTT(G/T)GCCAT | intron-variant | |
| rs1000101399 | -- | 22,317,108(+) | ATTTT(C/T)TTTAT | intron-variant | |
| rs1000117589 | -- | 22,218,420(+) | CCAGA(A/C)CAGCC | intron-variant |
| Variant ID | Type | Subtype | PubMed ID |
|---|---|---|---|
| dgv467e212 | CNV | loss | 25503493 |
| esv23565 | CNV | loss | 19812545 |
| esv2759883 | CNV | gain+loss | 17122850 |
| esv3304736 | CNV | mobile element insertion | 20981092 |
| esv33913 | CNV | gain | 17666407 |
| esv3435731 | CNV | insertion | 20981092 |
| esv3580188 | CNV | loss | 25503493 |
| nsv1070516 | CNV | deletion | 25765185 |
| nsv1119938 | CNV | deletion | 24896259 |
| nsv1119939 | CNV | deletion | 24896259 |
| nsv1130908 | CNV | deletion | 24896259 |
| nsv1146956 | CNV | deletion | 26484159 |
| nsv435637 | CNV | deletion | 17901297 |
| nsv476720 | CNV | novel sequence insertion | 20440878 |
| nsv482978 | CNV | loss | 15286789 |
| nsv521274 | CNV | loss | 19592680 |
Residual Variation Intolerance Score:
37.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
0.96;
19.81% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for ST8SIA1 Gene
- SNPedia medical, phenotypic, and genealogical associations of SNPs for
- ST8SIA1
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for ST8SIA1 Gene
Disorders for ST8SIA1 Gene
Relevant External Links for ST8SIA1
No disorders were found for ST8SIA1 Gene.
No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for ST8SIA1 Gene
Publications for ST8SIA1 Gene
- Variants in ST8SIA1 do not play a major role in susceptibility to multiple sclerosis in Canadian families. (PMID: 19428123) Ramagopalan S.V. … Ebers G.C. (J. Neuroimmunol. 2009) 3 22 46 64
- Variants of ST8SIA1 are associated with risk of developing multiple sclerosis. (PMID: 18612409) Husain S. … Vitale E. (PLoS ONE 2008) 3 22 46 64
- Isolation of GD3 synthase gene by expression cloning of GM3 alpha- 2,8-sialyltransferase cDNA using anti-GD2 monoclonal antibody. (PMID: 7937974) Haraguchi M. … Furukawa K. (Proc. Natl. Acad. Sci. U.S.A. 1994) 3 4 22 64
- Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
- Genome-wide association study identifies variants associated with histologic features of nonalcoholic Fatty liver disease. (PMID: 20708005) Chalasani N. … Rotter J.I. (Gastroenterology 2010) 3 46 64
Products for ST8SIA1 Gene
- R&D Systems Antibodies for ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1")
- R&D Systems Proteins and Enzymes for ST8SIA1 ("ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1")
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Browse OriGene Antibodies
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for ST8SIA1
- Search Origene for MassSpec and Protein Over-expression Lysates for ST8SIA1
- Origene Custom Protein Services for ST8SIA1
- Origene shRNA, siRNA, and RNAi products in human, mouse, rat for ST8SIA1
- Browse OriGene Inhibitory RNA Products For ST8SIA1
- OriGene qPCR primer pairs for ST8SIA1
- OriGene CRISPR knockouts for ST8SIA1
- OriGene ORF clones in human for ST8SIA1
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Browse OriGene miRNA Products For ST8SIA1
- GenScript: Next-day shipping cDNA ORF clone for ST8SIA1 in any vector
- GenScript Custom Purified and Recombinant Proteins Services for ST8SIA1
- GenScript Custom Assay Services for ST8SIA1
- GenScript Custom overexpressing Cell Line Services for ST8SIA1
- GenScript: Design CRISPR guide RNA sequences for ST8SIA1
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for ST8SIA1
- Sino Biological Human cDNA Clone for ST8SIA1
- Sino Biological Cell Lysates for ST8SIA1
- Sino Biological Recombinant Proteins for ST8SIA1
- Sino Biological Antibodies
- Sino Biological ELISA Kits and Pair Sets
- Sino Biological Cell Lysates
- Sino Biological qPCR Primers
- Sino Biological CRO Services for Proteins, Antibodies and Genes
- Sino Biological Transfection Reagents
- Novus Biologicals Antibodies for ST8SIA1
- Novus Biologicals proteins and lysates for ST8SIA1
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Invitrogen Antibodies for ST8SIA1
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- antibodies-online Antibodies for ST8SIA1: See all 7
- antibodies-online Kits for ST8SIA1: See all 1
- antibodies-online Proteins for ST8SIA1: See all 6
- Search antibodies-online for peptides
- GeneTex ST8SIA1 antibody for ST8SIA1
- Search GeneTex for Proteins for ST8SIA1
- ViGene Biosciences adenoviral particle packaged cDNA for ST8SIA1 gene
- ViGene Biosciences lentiviral particle packaged cDNA for ST8SIA1 gene
- ViGene Biosciences ready-to-package AAV shRNAs for ST8SIA1 gene
- Search ViGene Biosciences for ST8SIA1
- Santa Cruz Biotechnology (SCBT) Antibodies for ST8SIA1
- Search Santa Cruz Biotechnology (SCBT) for ST8SIA1 siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for ST8SIA1
- Horizon Cell Lines for ST8SIA1
- Cyagen custom Knockout/knockin (KOKI) mouse models for ST8SIA1
- VectorBuilder custom plasmid, inducible vectors for ST8SIA1
- VectorBuilder custom lentivirus, adenovirus, AAV vector/virus packaging for ST8SIA1
- VectorBuilder Other custom vectors
- Mammalian expression: PiggyBac
- Mammalian Tet-on expression: plasmid
- Mammalian conditional (Cre-Lox): plasmid and PiggyBac
- Mammalian shRNA knockdown: lentiviral, adenoviral, AAV, and PiggyBac
- CRISPR: plasmid gRNA, lentiviral gRNA, and donor plasmid
- Bacterial expression: pET, pBAD, and pCS
- Yeast expression
Sources for ST8SIA1 Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) IntAct
- (22) Novoseek
- (23) PharmGKB
- (24) DrugBank
- (25) HMDB
- (26) UniGene
- (27) AceView
- (28) RNAdb
- (29) ASD
- (30) ECgene
- (31) GeneAnnot
- (32) CGAP SAGE
- (33) SOURCE
- (34) HomoloGene
- (35) PanEnsembl
- (36) euGenes
- (37) SGD
- (38) FlyBase
- (39) WormBase
- (40) Pseudogene
- (41) DGV
- (42) dbSNP
- (43) GenAtlas
- (44) GeneTests
- (45) HGMD
- (46) GAD
- (47) LSDB
- (48) BGMUT
- (49) HuGE
- (50) eBioscience
- (51) Atlas
- (52) Cell Signaling Technology
- (53) GenBank
- (54) H-invDB
- (55) HORDE
- (56) HUGE
- (57) IMGT
- (58) Leiden
- (59) MILLIPORE
- (60) miRBase
- (61) DME
- (62) NCBI
- (63) OriGene
- (64) PubMed
- (65) R&D Systems
- (66) TGDB
- (67) Tocris
- (68) Abcam
- (69) Novus
- (70) ProSpec
- (71) Sino Biological
- (72) GenScript
- (73) Qiagen
- (74) Cloud-Clone Corp.
- (75) Enzo Life Sciences
- (76) OCA
- (77) Proteopedia
- (78) MOPED
- (79) SPIRE
- (80) neXtProt
- (81) Reactome
- (82) GeneGo (Thomson Reuters)
- (83) fRNAdb
- (84) DISEASES
- (85) SIMAP
- (86) GenomeRNAi
- (87) LifeMap
- (88) miRTarBase
- (89) MalaCards
- (90) Invitrogen
- (91) BitterDB
- (92) Vector BioLabs
- (93) ESI-BIO
- (94) RefSeq
- (95) BioSystems
- (96) MaxQB
- (97) IUPHAR
- (98) BioGPS
- (99) Illumina
- (100) COMPARTMENTS
- (101) HOMER
- (102) PaxDb
- (103) ApexBio
- (104) Addgene
- (105) antibodies-online
- (106) CYP
- (107) NONCODE
- (108) SwitchGear Genomics
- (109) TreeFam
- (110) PathCards
- (111) GeneReviews
- (112) GeneTex
- (113) Taconic Biosciences
- (114) GTEx
- (115) ProteomicsDB
- (116) SCBT
- (117) DGIdb
- (118) ClinicalTrials
- (119) FDA Approved Drugs
- (120) RVIS
- (121) SIGNOR
- (122) diseasecard
- (123) NIH Rare Diseases
- (124) Orphanet
- (125) UMLS
- (126) GTR
- (127) Disease Ontology
- (128) Genetics Home Reference
- (129) MeSH
- (130) MedlinePlus
- (131) CDC
- (132) NINDS
- (133) NCBI Bookshelf
- (134) ClinVar
- (135) Gene Damage Index
- (136) ViGene Biosciences
- (137) HPO
- (138) UDN
- (139) VISTA
- (140) FANTOM5
- (141) ENCODE
- (142) ProSci
- (143) Horizon
- (144) NURSA
- (145) IID
- (146) Cyagen
- (147) VectorBuilder
- (148) SNPedia
- (149) BRCA Exchange
- (150) St John's Lab
- (151) CIViC
- (152) ProteoGenix
- (153) dbSUPER
- (154) TISSUES
- (155) Gene ORGANizer