Free for academic non-profit institutions. Other users need a Commercial license

Aliases for SMURF2 Gene

Aliases for SMURF2 Gene

  • SMAD Specific E3 Ubiquitin Protein Ligase 2 2 3 5
  • HECT-Type E3 Ubiquitin Transferase SMURF2 3 4
  • SMAD Ubiquitination Regulatory Factor 2 3 4
  • HSMURF2 3 4
  • SMAD-Specific E3 Ubiquitin-Protein Ligase 2 4
  • E3 Ubiquitin-Protein Ligase SMURF2 3
  • E3 Ubiquitin Ligase SMURF2 3
  • EC 2.3.2.26 4
  • EC 6.3.2 61

External Ids for SMURF2 Gene

Previous GeneCards Identifiers for SMURF2 Gene

  • GC17P065700
  • GC17P068820
  • GC17M062959
  • GC17M063091
  • GC17M059971
  • GC17M062540
  • GC17M057990

Summaries for SMURF2 Gene

GeneCards Summary for SMURF2 Gene

SMURF2 (SMAD Specific E3 Ubiquitin Protein Ligase 2) is a Protein Coding gene. Diseases associated with SMURF2 include Hepatitis C Virus. Among its related pathways are Signaling by Wnt and CDK-mediated phosphorylation and removal of Cdc6. GO annotations related to this gene include identical protein binding and ubiquitin-protein transferase activity. An important paralog of this gene is SMURF1.

UniProtKB/Swiss-Prot for SMURF2 Gene

  • E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD1 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with SCYE1. Forms a stable complex with the TGF-beta receptor-mediated phosphorylated SMAD2 and SMAD3. In this way, SMAD2 may recruit substrates, such as SNON, for ubiquitin-mediated degradation. Enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level.

Gene Wiki entry for SMURF2 Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for SMURF2 Gene

Genomics for SMURF2 Gene

Regulatory Elements for SMURF2 Gene

Enhancers for SMURF2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH17G064705 1.9 FANTOM5 Ensembl ENCODE dbSUPER 34.7 -45.6 -45553 4.9 PKNOX1 ARNT SIN3A ZNF2 ZBTB7B ZNF766 ZNF143 FOS KLF13 DEK SMURF2 GC17M064748
GH17G064678 1.8 FANTOM5 Ensembl ENCODE dbSUPER 25.9 -19.2 -19232 6.4 FOXA2 PKNOX1 ZFP64 SIN3A ZBTB7B GTF3C2 FOS SP5 ZHX2 ZNF592 SMURF2 PLEKHM1P1 ENSG00000265982 POLG2 SLC16A6P1 CEP95 DDX5 DDX42 GC17M064748
GH17G064713 1.3 Ensembl ENCODE dbSUPER 31.3 -51.1 -51114 2.0 CTCF GTF2F1 CBX3 NFIB SUZ12 ZBTB7B GATA3 CTBP1 CBX5 ELK1 SMURF2 CEP95 ENSG00000265912 DDX42 ENSG00000264057 GC17M064748
GH17G064693 1.5 Ensembl ENCODE dbSUPER 22 -32.1 -32072 1.7 HDGF PKNOX1 FOXA2 ARID4B YY1 ZNF207 FOS ZHX2 MIER2 PPARG SMURF2 GC17M064748
GH17G064685 1 dbSUPER 21.8 -23.7 -23669 1.3 HDGF ATF1 PKNOX1 ARNT CREB3L1 TCF12 ZNF766 GATA2 ELK1 NCOA1 SMURF2 GC17M064748
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around SMURF2 on UCSC Golden Path with GeneCards custom track

Promoters for SMURF2 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000096996 868 3201 PKNOX1 ARNT SIN3A DMAP1 ZNF2 ZBTB7B YY1 ZNF143 ZNF207 SP5

Genomic Location for SMURF2 Gene

Chromosome:
17
Start:
64,542,282 bp from pter
End:
64,662,268 bp from pter
Size:
119,987 bases
Orientation:
Minus strand

Genomic View for SMURF2 Gene

Genes around SMURF2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
SMURF2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for SMURF2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for SMURF2 Gene

Proteins for SMURF2 Gene

  • Protein details for SMURF2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9HAU4-SMUF2_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase SMURF2
    Protein Accession:
    Q9HAU4
    Secondary Accessions:
    • Q52LL1
    • Q9H260

    Protein attributes for SMURF2 Gene

    Size:
    748 amino acids
    Molecular mass:
    86196 Da
    Quaternary structure:
    • Interacts (via WW domains) with SMAD1. Interacts (via WW domains) with SMAD2 (via PY-motif). Interacts (via WW domains) with SMAD3 (via PY-motif). Interacts with SMAD6. Interacts with SMAD7 (via PY-motif) and TGFBR1; SMAD7 recruits SMURF2 to the TGF-beta receptor and regulates its degradation. Does not interact with SMAD4; SMAD4 lacks a PY-motif. Interacts with AIMP1. Interacts with STAMBP and RNF11. Interacts with NDFIP1 and NDFIP2 (Probable); this interaction activates the E3 ubiquitin-protein ligase.

    Three dimensional structures from OCA and Proteopedia for SMURF2 Gene

neXtProt entry for SMURF2 Gene

Selected DME Specific Peptides for SMURF2 Gene

Q9HAU4:
  • RTTQQGQVYF
  • PLPPGWE
  • RGIEAQFLALQKGFNE
  • LQINPDS
  • LLQFVTGSSRVP
  • RLTVLCAKNL
  • EVSREEIFEESYRQ
  • GFTLPFYK
  • TQWERPTRPASEYSSPGRPLSC
  • VLDHTFCVEHNA
  • QPQAGHCR
  • VRGQIVVSLQ
  • GFKALQG
  • NPYYGLF
  • NTRLKHC
  • YFVDHNNRTTQFTDPRL
  • TGVSTWHDPR
  • NLPKAHTCFNRID
  • MKMRPKDL
  • RLLQFVTG
  • HLSYFHFVGR
  • KFRGEEGLDYGGVAREWLYLL
  • LPEGYEQRTT
  • VVDCSRLFDNDLPDGWEERRTASGRIQYLNHITR
  • PLQGFKAL
  • GPRLFTIH

Post-translational modifications for SMURF2 Gene

  • Auto-ubiquitinated and ubiquitinated in the presence of RNF11 and UBE2D1. Ubiquitinated by the SCF(FBXL15) complex, leading to its degradation by the proteasome.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for SMURF2 Gene

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for SMURF2 (SMURF2)
  • Santa Cruz Biotechnology (SCBT) Antibodies for SMURF2

Domains & Families for SMURF2 Gene

Gene Families for SMURF2 Gene

Protein Domains for SMURF2 Gene

Suggested Antigen Peptide Sequences for SMURF2 Gene

Graphical View of Domain Structure for InterPro Entry

Q9HAU4

UniProtKB/Swiss-Prot:

SMUF2_HUMAN :
  • The second and third WW domains are responsible for interaction with the PY-motif of R-SMAD (SMAD1, SMAD2 and SMAD3).
Domain:
  • The second and third WW domains are responsible for interaction with the PY-motif of R-SMAD (SMAD1, SMAD2 and SMAD3).
  • The C2 domain is involved in autoinhibition of the catalytic activity by interacting with the HECT domain.
genes like me logo Genes that share domains with SMURF2: view

Function for SMURF2 Gene

Molecular function for SMURF2 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by NDFIP1- and NDFIP2-binding.
UniProtKB/Swiss-Prot Function:
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD1 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with SCYE1. Forms a stable complex with the TGF-beta receptor-mediated phosphorylated SMAD2 and SMAD3. In this way, SMAD2 may recruit substrates, such as SNON, for ubiquitin-mediated degradation. Enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level.

Enzyme Numbers (IUBMB) for SMURF2 Gene

Gene Ontology (GO) - Molecular Function for SMURF2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004842 ubiquitin-protein transferase activity TAS,IEA --
GO:0005160 transforming growth factor beta receptor binding IEA --
GO:0005515 protein binding IPI 14755250
GO:0016740 transferase activity IEA --
GO:0042802 identical protein binding IPI 15231748
genes like me logo Genes that share ontologies with SMURF2: view
genes like me logo Genes that share phenotypes with SMURF2: view

Animal Models for SMURF2 Gene

MGI Knock Outs for SMURF2:

Animal Model Products

  • Taconic Biosciences Mouse Models for SMURF2

CRISPR Products

Inhibitory RNA Products

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for SMURF2 Gene

Localization for SMURF2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for SMURF2 Gene

Nucleus. Cytoplasm. Cell membrane. Membrane raft. Note=Cytoplasmic in the presence of SMAD7. Colocalizes with CAV1, SMAD7 and TGF-beta receptor in membrane rafts.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for SMURF2 gene
Compartment Confidence
nucleus 5
cytosol 5
plasma membrane 4
mitochondrion 3
extracellular 2
peroxisome 2

Gene Ontology (GO) - Cellular Components for SMURF2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000151 ubiquitin ligase complex IDA 14755250
GO:0005634 nucleus NAS 11163210
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with SMURF2: view

Pathways & Interactions for SMURF2 Gene

genes like me logo Genes that share pathways with SMURF2: view

UniProtKB/Swiss-Prot Q9HAU4-SMUF2_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

SIGNOR curated interactions for SMURF2 Gene

Inactivates:
Is activated by:

Gene Ontology (GO) - Biological Process for SMURF2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription from RNA polymerase II promoter TAS --
GO:0000209 protein polyubiquitination TAS --
GO:0006511 ubiquitin-dependent protein catabolic process IDA 14755250
GO:0016567 protein ubiquitination IEA --
GO:0016579 protein deubiquitination TAS --
genes like me logo Genes that share ontologies with SMURF2: view

Drugs & Compounds for SMURF2 Gene

(3) Drugs for SMURF2 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved Nutra 0
Adenosine triphosphate Approved Nutra 0

(1) Additional Compounds for SMURF2 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
genes like me logo Genes that share compounds with SMURF2: view

Transcripts for SMURF2 Gene

Unigene Clusters for SMURF2 Gene

SMAD specific E3 ubiquitin protein ligase 2:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for SMURF2 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15a · 15b ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21
SP1: - - -
SP2:
SP3:

Relevant External Links for SMURF2 Gene

GeneLoc Exon Structure for
SMURF2
ECgene alternative splicing isoforms for
SMURF2

Expression for SMURF2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for SMURF2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for SMURF2 Gene

This gene is overexpressed in Breast (67.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for SMURF2 Gene



Protein tissue co-expression partners for SMURF2 Gene

NURSA nuclear receptor signaling pathways regulating expression of SMURF2 Gene:

SMURF2

SOURCE GeneReport for Unigene cluster for SMURF2 Gene:

Hs.515011

mRNA Expression by UniProt/SwissProt for SMURF2 Gene:

Q9HAU4-SMUF2_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for SMURF2 Gene

  • Nervous system(4.2)
  • Kidney(2.1)
genes like me logo Genes that share expression patterns with SMURF2: view

Primer Products

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for SMURF2 Gene

Orthologs for SMURF2 Gene

This gene was present in the common ancestor of animals.

Orthologs for SMURF2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia SMURF2 34 35
  • 99.82 (n)
oppossum
(Monodelphis domestica)
Mammalia SMURF2 35
  • 98 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 97 (a)
OneToMany
-- 35
  • 96 (a)
OneToMany
-- 35
  • 60 (a)
OneToMany
dog
(Canis familiaris)
Mammalia SMURF2 34
  • 95.3 (n)
cow
(Bos Taurus)
Mammalia SMURF2 34 35
  • 94.26 (n)
mouse
(Mus musculus)
Mammalia Smurf2 34 16 35
  • 92.07 (n)
rat
(Rattus norvegicus)
Mammalia Smurf2 34
  • 91.49 (n)
chicken
(Gallus gallus)
Aves SMURF2 34 35
  • 86.76 (n)
lizard
(Anolis carolinensis)
Reptilia SMURF2 35
  • 97 (a)
OneToOne
zebrafish
(Danio rerio)
Actinopterygii smurf2 34 35
  • 76.02 (n)
fruit fly
(Drosophila melanogaster)
Insecta lack 36 34 35
  • 60.25 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP011242 34
  • 57.8 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.8773 35
  • 66 (a)
OneToMany
Species where no ortholog for SMURF2 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for SMURF2 Gene

ENSEMBL:
Gene Tree for SMURF2 (if available)
TreeFam:
Gene Tree for SMURF2 (if available)

Paralogs for SMURF2 Gene

Paralogs for SMURF2 Gene

Pseudogenes.org Pseudogenes for SMURF2 Gene

genes like me logo Genes that share paralogs with SMURF2: view

Variants for SMURF2 Gene

Sequence variations from dbSNP and Humsavar for SMURF2 Gene

SNP ID Clin Chr 17 pos Sequence Context AA Info Type
rs1000080779 -- 64,623,199(+) ATCCA(C/T)AAAGA intron-variant
rs1000081556 -- 64,572,533(+) TTACC(A/C)AGAGT intron-variant
rs1000115261 -- 64,653,637(+) GAGAC(A/G)GAGTT intron-variant
rs1000124956 -- 64,622,957(+) TGTTT(C/T)GTACT intron-variant
rs1000163009 -- 64,659,562(+) TTAAA(G/T)ATTTT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for SMURF2 Gene

Variant ID Type Subtype PubMed ID
dgv3274n100 CNV gain 25217958
esv2656677 CNV deletion 23128226
esv3641029 CNV loss 21293372
nsv1066765 CNV gain 25217958
nsv1070413 CNV deletion 25765185
nsv960137 CNV duplication 23825009
nsv960138 CNV duplication 23825009

Variation tolerance for SMURF2 Gene

Residual Variation Intolerance Score: 15.8% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.33; 41.47% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for SMURF2 Gene

Human Gene Mutation Database (HGMD)
SMURF2
SNPedia medical, phenotypic, and genealogical associations of SNPs for
SMURF2

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for SMURF2 Gene

Disorders for SMURF2 Gene

MalaCards: The human disease database

(1) MalaCards diseases for SMURF2 Gene - From: GeneCards

Disorder Aliases PubMed IDs
hepatitis c virus
  • hepatitic c virus
- elite association - COSMIC cancer census association via MalaCards

Relevant External Links for SMURF2

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
SMURF2
genes like me logo Genes that share disorders with SMURF2: view

No data available for UniProtKB/Swiss-Prot and Genatlas for SMURF2 Gene

Publications for SMURF2 Gene

  1. Autoinhibition of the HECT-type ubiquitin ligase Smurf2 through its C2 domain. (PMID: 17719543) Wiesner S. … Forman-Kay J.D. (Cell 2007) 3 4 22 64
  2. An expanded WW domain recognition motif revealed by the interaction between Smad7 and the E3 ubiquitin ligase Smurf2. (PMID: 16641086) Chong P.A. … Forman-Kay J.D. (J. Biol. Chem. 2006) 3 4 22 64
  3. Regulation of Smurf2 ubiquitin ligase activity by anchoring the E2 to the HECT domain. (PMID: 16061177) Ogunjimi A.A. … Wrana J.L. (Mol. Cell 2005) 3 4 22 64
  4. The RING-H2 protein RNF11 is overexpressed in breast cancer and is a target of Smurf2 E3 ligase. (PMID: 14562029) Subramaniam V. … Seth A.K. (Br. J. Cancer 2003) 3 4 22 64
  5. Regulation of Smad degradation and activity by Smurf2, an E3 ubiquitin ligase. (PMID: 11158580) Zhang Y. … Derynck R. (Proc. Natl. Acad. Sci. U.S.A. 2001) 3 4 22 64

Products for SMURF2 Gene

Sources for SMURF2 Gene

Content
Loading form....