Free for academic non-profit institutions. Other users need a Commercial license

Aliases for RPS6KB1 Gene

Aliases for RPS6KB1 Gene

  • Ribosomal Protein S6 Kinase B1 2 3 5
  • Serine/Threonine-Protein Kinase 14A 3 4
  • Ribosomal Protein S6 Kinase I 3 4
  • EC 2.7.11.1 4 61
  • S6K-Beta-1 3 4
  • P70 S6KA 3 4
  • STK14A 3 4
  • S6K1 3 4
  • Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 3
  • Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1 2
  • 70 KDa Ribosomal Protein S6 Kinase 1 4
  • Ribosomal Protein S6 Kinase Beta-1 3
  • Serine/Threonine Kinase 14 Alpha 3
  • P70 Ribosomal S6 Kinase Alpha 4
  • P70 S6 Kinase, Alpha 3
  • P70 S6 Kinase Alpha 4
  • P70(S6K)-Alpha 3
  • P70 S6K-Alpha 4
  • P70-Alpha 3
  • P70-S6K 1 4
  • EC 2.7.11 61
  • P70-S6K 3
  • P70S6K1 4
  • PS6K 3
  • S6K 3

External Ids for RPS6KB1 Gene

Previous HGNC Symbols for RPS6KB1 Gene

  • STK14A

Previous GeneCards Identifiers for RPS6KB1 Gene

  • GC17M060023
  • GC17P060420
  • GC17P058312
  • GC17P058444
  • GC17P055325
  • GC17P057970
  • GC17P053343

Summaries for RPS6KB1 Gene

Entrez Gene Summary for RPS6KB1 Gene

  • This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17. [provided by RefSeq, Jan 2013]

GeneCards Summary for RPS6KB1 Gene

RPS6KB1 (Ribosomal Protein S6 Kinase B1) is a Protein Coding gene. Diseases associated with RPS6KB1 include Tuberous Sclerosis and Glioblastoma Multiforme. Among its related pathways are Development IGF-1 receptor signaling and RET signaling. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is RPS6KB2.

UniProtKB/Swiss-Prot for RPS6KB1 Gene

  • Serine/threonine-protein kinase that acts downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression. Regulates protein synthesis through phosphorylation of EIF4B, RPS6 and EEF2K, and contributes to cell survival by repressing the pro-apoptotic function of BAD. Under conditions of nutrient depletion, the inactive form associates with the EIF3 translation initiation complex. Upon mitogenic stimulation, phosphorylation by the mammalian target of rapamycin complex 1 (mTORC1) leads to dissociation from the EIF3 complex and activation. The active form then phosphorylates and activates several substrates in the pre-initiation complex, including the EIF2B complex and the cap-binding complex component EIF4B. Also controls translation initiation by phosphorylating a negative regulator of EIF4A, PDCD4, targeting it for ubiquitination and subsequent proteolysis. Promotes initiation of the pioneer round of protein synthesis by phosphorylating POLDIP3/SKAR. In response to IGF1, activates translation elongation by phosphorylating EEF2 kinase (EEF2K), which leads to its inhibition and thus activation of EEF2. Also plays a role in feedback regulation of mTORC2 by mTORC1 by phosphorylating RICTOR, resulting in the inhibition of mTORC2 and AKT1 signaling. Mediates cell survival by phosphorylating the pro-apoptotic protein BAD and suppressing its pro-apoptotic function. Phosphorylates mitochondrial URI1 leading to dissociation of a URI1-PPP1CC complex. The free mitochondrial PPP1CC can then dephosphorylate RPS6KB1 at Thr-412, which is proposed to be a negative feedback mechanism for the RPS6KB1 anti-apoptotic function. Mediates TNF-alpha-induced insulin resistance by phosphorylating IRS1 at multiple serine residues, resulting in accelerated degradation of IRS1. In cells lacking functional TSC1-2 complex, constitutively phosphorylates and inhibits GSK3B. May be involved in cytoskeletal rearrangement through binding to neurabin. Phosphorylates and activates the pyrimidine biosynthesis enzyme CAD, downstream of MTOR.

Tocris Summary for RPS6KB1 Gene

  • Ribosomal S6 protein kinases (RSKs) are a family of protein serine/threonine kinases that regulate diverse cellular processes such as cellular growth, motility, survival and proliferation. The RSK family can be divided into two subfamilies, namely p90 RSK and p70 S6K.

Gene Wiki entry for RPS6KB1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for RPS6KB1 Gene

Genomics for RPS6KB1 Gene

Regulatory Elements for RPS6KB1 Gene

Enhancers for RPS6KB1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH17G059824 2.4 VISTA FANTOM5 Ensembl ENCODE dbSUPER 23.7 -50.2 -50161 36.2 CREB3L1 MLX AGO1 ZFP64 DMAP1 YBX1 FEZF1 YY1 SLC30A9 ZNF143 RPS6KB1 NDUFB8P2 LOC101927755 PPM1D TUBD1 VMP1 PTRH2 APPBP2 SMG8 RNFT1
GH17G059751 2 FANTOM5 Ensembl ENCODE dbSUPER 21.5 -131.6 -131562 20.4 HDGF PKNOX1 FOXA2 MLX ZFP64 ARID4B SIN3A YBX1 DMAP1 FEZF1 RPS6KB1 NDUFB8P2 LOC101927755 MIR21 RNU6-450P TUBD1 PPM1D SMG8 CA4 DHX40
GH17G059151 1.7 FANTOM5 Ensembl ENCODE 21.1 -736.8 -736756 9.6 CREB3L1 ZFP64 YBX1 DMAP1 YY1 SLC30A9 ZNF263 SP3 NFYC TBX21 NDUFB8P2 TRIM37 RPS6KB1 SMG8 RAD51C RNU2-58P DHX40 PRR11 GC17M059158
GH17G060598 1.5 FANTOM5 ENCODE 21.8 +707.8 707835 4.9 MLX CREB3L1 AGO1 DMAP1 FEZF1 YY1 SLC30A9 ZNF143 ZNF263 SP3 PPM1D RPS6KB1 ENSG00000266934 C17orf82 NACA2 RNU6-623P GC17M060663
GH17G059781 2.3 VISTA FANTOM5 Ensembl ENCODE dbSUPER 14.1 -105.4 -105372 11.9 CREB3L1 MLX ZFP64 YBX1 FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 LOC101927755 DHX40 SKA2 RPS6KB1 LOC100996660 MIR21 RNU6-450P PPM1D TRIM37 VMP1
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around RPS6KB1 on UCSC Golden Path with GeneCards custom track

Promoters for RPS6KB1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000096430 54 2201 HDGF PKNOX1 CREB3L1 AGO1 WRNIP1 ARID4B SIN3A DMAP1 ZNF2 YY1

Genomic Location for RPS6KB1 Gene

Chromosome:
17
Start:
59,893,046 bp from pter
End:
59,950,564 bp from pter
Size:
57,519 bases
Orientation:
Plus strand

Genomic View for RPS6KB1 Gene

Genes around RPS6KB1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RPS6KB1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RPS6KB1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for RPS6KB1 Gene

Proteins for RPS6KB1 Gene

  • Protein details for RPS6KB1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P23443-KS6B1_HUMAN
    Recommended name:
    Ribosomal protein S6 kinase beta-1
    Protein Accession:
    P23443
    Secondary Accessions:
    • B2R779
    • B4DLT4
    • B4DTG1
    • E7ESB8
    • F6UYM1
    • Q7Z721

    Protein attributes for RPS6KB1 Gene

    Size:
    525 amino acids
    Molecular mass:
    59140 Da
    Quaternary structure:
    • Interacts with PPP1R9A/neurabin-1 (By similarity). Interacts with RPTOR (PubMed:12150926). Interacts with IRS1 (PubMed:18952604). Interacts with EIF3B and EIF3C (PubMed:16286006). Interacts with TRAF4 (PubMed:12801526). Interacts with POLDIP3 (PubMed:15341740). Interacts (via N-terminus) with IER5 (PubMed:26496226).

    Three dimensional structures from OCA and Proteopedia for RPS6KB1 Gene

    Alternative splice isoforms for RPS6KB1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for RPS6KB1 Gene

Selected DME Specific Peptides for RPS6KB1 Gene

P23443:
  • YMAPEIL
  • GIIYRDLK
  • REAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHG
  • SEEDVSQ
  • LQSEEDVSQFD
  • KLTDFGLCKESIH
  • YAFQTGGKLYLILE
  • FLGFTYVAPSVL
  • FCGTIEYMAP
  • GHNRAVDWWSLGALMYDMLTG
  • KGGYGKVF
  • SGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
  • EDTACFYLAEI
  • LGKGGYG
  • KLTDFGL
  • AKDTAHT
  • RDLKPEN
  • FTRQTPVDSPDD
  • DFGLCKE

Post-translational modifications for RPS6KB1 Gene

  • Phosphorylation at Thr-412 is regulated by mTORC1. The phosphorylation at this site is maintained by an agonist-dependent autophosphorylation mechanism (By similarity). Activated by phosphorylation at Thr-252 by PDPK1. Dephosphorylation by PPP1CC at Thr-412 in mitochondrion.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • R&D Systems Antibodies for RPS6KB1 (p70 S6 Kinase)
  • Cell Signaling Technology (CST) Antibodies for RPS6KB1 (p70S6K)
  • Cloud-Clone Corp. Antibodies for RPS6KB1

Assay Products

  • Cloud-Clone Corp Assay Kits for RPS6KB1

Domains & Families for RPS6KB1 Gene

Graphical View of Domain Structure for InterPro Entry

P23443

UniProtKB/Swiss-Prot:

KS6B1_HUMAN :
  • The autoinhibitory domain is believed to block phosphorylation within the AGC-kinase C-terminal domain and the activation loop.
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
Domain:
  • The autoinhibitory domain is believed to block phosphorylation within the AGC-kinase C-terminal domain and the activation loop.
  • The TOS (TOR signaling) motif is essential for activation by mTORC1.
Family:
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
genes like me logo Genes that share domains with RPS6KB1: view

Function for RPS6KB1 Gene

Molecular function for RPS6KB1 Gene

GENATLAS Biochemistry:
ribosomal protein S6 kinase,70kDa,polypeptide 1,widely expressed,not involved in vivo in the phosphorylation of RPS6,mediating protein synthesis initiation and elongation induced by hormones or growth factors,maybe playing an essential regulatory role in protein synthesis during cell proliferation
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activation requires multiple phosphorylation events on serine/threonine residues. Activation appears to be first mediated by phosphorylation of multiple sites in the autoinhibitory domain, which facilitates phosphorylation at Thr-412, disrupting the autoinhibitory mechanism and allowing phosphorylation of Thr-252 by PDPK1. The active conformation of the kinase is believed to be stabilized by a mechanism involving three conserved phosphorylation sites located in the kinase domain activation loop (Thr-252) and in the AGC-kinase C-terminal domain (Ser-394 in the middle of the tail/linker region and Thr-412 within a hydrophobic motif at its end). Activated by mTORC1; isoform Alpha I and isoform Alpha II are sensitive to rapamycin, which inhibits activating phosphorylation at Thr-412. Activated by PDPK1.
UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase that acts downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression. Regulates protein synthesis through phosphorylation of EIF4B, RPS6 and EEF2K, and contributes to cell survival by repressing the pro-apoptotic function of BAD. Under conditions of nutrient depletion, the inactive form associates with the EIF3 translation initiation complex. Upon mitogenic stimulation, phosphorylation by the mammalian target of rapamycin complex 1 (mTORC1) leads to dissociation from the EIF3 complex and activation. The active form then phosphorylates and activates several substrates in the pre-initiation complex, including the EIF2B complex and the cap-binding complex component EIF4B. Also controls translation initiation by phosphorylating a negative regulator of EIF4A, PDCD4, targeting it for ubiquitination and subsequent proteolysis. Promotes initiation of the pioneer round of protein synthesis by phosphorylating POLDIP3/SKAR. In response to IGF1, activates translation elongation by phosphorylating EEF2 kinase (EEF2K), which leads to its inhibition and thus activation of EEF2. Also plays a role in feedback regulation of mTORC2 by mTORC1 by phosphorylating RICTOR, resulting in the inhibition of mTORC2 and AKT1 signaling. Mediates cell survival by phosphorylating the pro-apoptotic protein BAD and suppressing its pro-apoptotic function. Phosphorylates mitochondrial URI1 leading to dissociation of a URI1-PPP1CC complex. The free mitochondrial PPP1CC can then dephosphorylate RPS6KB1 at Thr-412, which is proposed to be a negative feedback mechanism for the RPS6KB1 anti-apoptotic function. Mediates TNF-alpha-induced insulin resistance by phosphorylating IRS1 at multiple serine residues, resulting in accelerated degradation of IRS1. In cells lacking functional TSC1-2 complex, constitutively phosphorylates and inhibits GSK3B. May be involved in cytoskeletal rearrangement through binding to neurabin. Phosphorylates and activates the pyrimidine biosynthesis enzyme CAD, downstream of MTOR.

Enzyme Numbers (IUBMB) for RPS6KB1 Gene

Gene Ontology (GO) - Molecular Function for RPS6KB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity TAS,IDA 17936702
GO:0004674 protein serine/threonine kinase activity IBA --
GO:0004711 ribosomal protein S6 kinase activity IEA --
GO:0004712 protein serine/threonine/tyrosine kinase activity IDA 22797923
genes like me logo Genes that share ontologies with RPS6KB1: view
genes like me logo Genes that share phenotypes with RPS6KB1: view

Animal Models for RPS6KB1 Gene

MGI Knock Outs for RPS6KB1:

Animal Model Products

  • Taconic Biosciences Mouse Models for RPS6KB1

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for RPS6KB1 Gene

Localization for RPS6KB1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for RPS6KB1 Gene

Cell junction, synapse, synaptosome. Mitochondrion outer membrane. Mitochondrion. Note=Colocalizes with URI1 at mitochondrion.
Isoform Alpha I: Nucleus. Cytoplasm.
Isoform Alpha II: Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RPS6KB1 gene
Compartment Confidence
mitochondrion 5
nucleus 5
cytosol 5
plasma membrane 2
extracellular 2
cytoskeleton 2
lysosome 2
golgi apparatus 2
endoplasmic reticulum 1
endosome 1

Gene Ontology (GO) - Cellular Components for RPS6KB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IBA,IEA --
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IEA --
GO:0005739 mitochondrion IEA,IDA 17936702
GO:0005741 mitochondrial outer membrane IEA --
genes like me logo Genes that share ontologies with RPS6KB1: view

Pathways & Interactions for RPS6KB1 Gene

SuperPathways for RPS6KB1 Gene

genes like me logo Genes that share pathways with RPS6KB1: view

Pathways by source for RPS6KB1 Gene

SIGNOR curated interactions for RPS6KB1 Gene

Activates:
Inactivates:
Is activated by:
Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for RPS6KB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000082 G1/S transition of mitotic cell cycle IMP 14673156
GO:0001662 behavioral fear response IEA --
GO:0003009 skeletal muscle contraction IEA --
GO:0006417 regulation of translation IEA --
GO:0006468 protein phosphorylation IEA --
genes like me logo Genes that share ontologies with RPS6KB1: view

Drugs & Compounds for RPS6KB1 Gene

(58) Drugs for RPS6KB1 Gene - From: PharmGKB, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Everolimus Approved Pharma mTOR inhibitor, mTOR Inhibitors, Kinase Inhibitors, Mammalian target of rapamycin (mTOR) inhibitors 1940
Adenosine triphosphate Approved Nutra 0
XL418 Investigational Pharma inhibitor 0
PF-4708671 Pharma P70 S6K1 isoform inhibitor,cell-permeable, S6K1 inhibitor 0
A-443654 Pharma Akt inhibitor,potent and selective 0

(30) Additional Compounds for RPS6KB1 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0

(3) Tocris Compounds for RPS6KB1 Gene

Compound Action Cas Number
BRD 7389 Ribosomal S6 kinase inhibitor 376382-11-5
PF 4708671 S6K1 inhibitor 1255517-76-0
SL 0101-1 Selective ribosomal S6 kinase (RSK) inhibitor 77307-50-7

(7) ApexBio Compounds for RPS6KB1 Gene

Compound Action Cas Number
A-443654 Akt inhibitor,potent and selective 552325-16-3
AT7867 Akt1/2/3 and p70S6K/PKA inhibitor 857531-00-1
BI-D1870 P90 RSK inhibitor,ATP-competitive and cell-permeable 501437-28-1
FMK RSK inhibitor 821794-92-7
H 89 2HCl Potent PKA inhibitor 130964-39-5
LY2584702 p70 S6 kinase inhibitor 1082949-67-4
PF-4708671 P70 S6K1 isoform inhibitor,cell-permeable 1255517-76-0
genes like me logo Genes that share compounds with RPS6KB1: view

Transcripts for RPS6KB1 Gene

Unigene Clusters for RPS6KB1 Gene

Ribosomal protein S6 kinase, 70kDa, polypeptide 1:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for RPS6KB1 Gene

No ASD Table

Relevant External Links for RPS6KB1 Gene

GeneLoc Exon Structure for
RPS6KB1
ECgene alternative splicing isoforms for
RPS6KB1

Expression for RPS6KB1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for RPS6KB1 Gene

Protein differential expression in normal tissues from HIPED for RPS6KB1 Gene

This gene is overexpressed in CD8 Tcells (13.8), Fetal testis (8.2), Placenta (7.4), NK cells (7.3), and Ovary (6.6).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for RPS6KB1 Gene



Protein tissue co-expression partners for RPS6KB1 Gene

NURSA nuclear receptor signaling pathways regulating expression of RPS6KB1 Gene:

RPS6KB1

SOURCE GeneReport for Unigene cluster for RPS6KB1 Gene:

Hs.463642

mRNA Expression by UniProt/SwissProt for RPS6KB1 Gene:

P23443-KS6B1_HUMAN
Tissue specificity: Widely expressed.

Evidence on tissue expression from TISSUES for RPS6KB1 Gene

  • Eye(4.3)
  • Nervous system(3.8)
  • Muscle(3.3)
  • Heart(2.7)
  • Liver(2.7)
  • Blood(2.3)
  • Intestine(2.3)
  • Kidney(2.3)
  • Lung(2.3)
  • Pancreas(2.2)
  • Skin(2)
  • Thyroid gland(2)
genes like me logo Genes that share expression patterns with RPS6KB1: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for RPS6KB1 Gene

Orthologs for RPS6KB1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for RPS6KB1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia RPS6KB1 34 35
  • 99.94 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia RPS6KB1 35
  • 99 (a)
OneToOne
dog
(Canis familiaris)
Mammalia RPS6KB1 34 35
  • 97.33 (n)
oppossum
(Monodelphis domestica)
Mammalia RPS6KB1 35
  • 97 (a)
OneToOne
cow
(Bos Taurus)
Mammalia RPS6KB1 34 35
  • 96.38 (n)
rat
(Rattus norvegicus)
Mammalia Rps6kb1 34
  • 95.94 (n)
mouse
(Mus musculus)
Mammalia Rps6kb1 34 16 35
  • 94.6 (n)
chicken
(Gallus gallus)
Aves RPS6KB1 34 35
  • 88.58 (n)
lizard
(Anolis carolinensis)
Reptilia RPS6KB1 35
  • 95 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia rps6kb1 34
  • 83.14 (n)
LOC394938 34
African clawed frog
(Xenopus laevis)
Amphibia rps6kb1-A 34
zebrafish
(Danio rerio)
Actinopterygii rps6kb1a 35
  • 77 (a)
OneToMany
rps6kb1b 34 35
  • 74.3 (n)
Dr.24528 34
fruit fly
(Drosophila melanogaster)
Insecta S6k 36 34 35
  • 65.85 (n)
Pk17E 36
  • 36 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP007333 34
  • 61.86 (n)
worm
(Caenorhabditis elegans)
Secernentea rsks-1 34 35
  • 63.15 (n)
Y47D3A.16 36
  • 60 (a)
R04A9.5 36
  • 48 (a)
F28C10.3 36
  • 34 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes SCH9 35
  • 22 (a)
OneToMany
YPK3 37
thale cress
(Arabidopsis thaliana)
eudicotyledons PK1 34
  • 52.08 (n)
rice
(Oryza sativa)
Liliopsida Os03g0334000 34
  • 54.9 (n)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.3064 34
Species where no ortholog for RPS6KB1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for RPS6KB1 Gene

ENSEMBL:
Gene Tree for RPS6KB1 (if available)
TreeFam:
Gene Tree for RPS6KB1 (if available)

Paralogs for RPS6KB1 Gene

genes like me logo Genes that share paralogs with RPS6KB1: view

Variants for RPS6KB1 Gene

Sequence variations from dbSNP and Humsavar for RPS6KB1 Gene

SNP ID Clin Chr 17 pos Sequence Context AA Info Type
VAR_035628 A colorectal cancer sample
rs1000021445 -- 59,891,985(+) AAATT(A/T)AAATT intron-variant, upstream-variant-2KB
rs1000078566 -- 59,899,158(+) AAGAT(C/T)GCGCC intron-variant
rs1000088639 -- 59,899,538(+) AAAAC(A/G)ATTAT intron-variant
rs1000165924 -- 59,930,330(+) GCTAT(A/G)GAGGT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for RPS6KB1 Gene

Variant ID Type Subtype PubMed ID
esv24411 CNV gain 19812545
esv2758700 CNV gain+loss 17122850
nsv428348 CNV gain 18775914
nsv471544 CNV gain 19718026
nsv471702 CNV gain 15918152
nsv833502 CNV gain 17160897
nsv9576 CNV gain+loss 18304495
nsv960129 CNV duplication 23825009

Variation tolerance for RPS6KB1 Gene

Residual Variation Intolerance Score: 19.5% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.24; 5.38% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for RPS6KB1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
RPS6KB1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for RPS6KB1 Gene

Disorders for RPS6KB1 Gene

MalaCards: The human disease database

(10) MalaCards diseases for RPS6KB1 Gene - From: DISEASES, Novoseek, and GeneCards