Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 



RPP40 Gene

protein-coding   GIFtS: 50
GCID: GC06M004942

Ribonuclease P/MRP 40kDa Subunit

(Previous names: ribonuclease P1, ribonuclease P 40kDa subunit)
(Previous symbol: RNASEP1)
  Try our

disease database 

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

TryGeneCards Plus

Aliases
Ribonuclease P/MRP 40kDa Subunit1 2     Ribonuclease P 40kDa Subunit1
RNASEP11 2 3     bA428J1.32
Ribonuclease P11 2     Ribonuclease P (40 KD)2
RNase P Subunit 12 3     Ribonuclease P Protein Subunit P402
RNaseP Protein P402 3     Ribonuclease P, 40kD Subunit2
EC 3.1.26.53 8     

External Ids:    HGNC: 209921   Entrez Gene: 107992   Ensembl: ENSG000001247877   OMIM: 6061175   UniProtKB: O758183   

Export aliases for RPP40 gene to outside databases

Previous GC identifers: GC06M004980 GC06M004941


(According to Entrez Gene, GeneCards, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

TryGeneCards Plus

GeneCards Summary for RPP40 Gene:
RPP40 (ribonuclease P/MRP 40kDa subunit) is a protein-coding gene. GO annotations related to this gene include ribonuclease P activity.

UniProtKB/Swiss-Prot: RPP40_HUMAN, O75818
Function: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their
5'-ends

Gene Wiki entry for RPP40 Gene


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 75), Regulatory elements and Epigenetics data according to QIAGEN, and/or SwitchGear Genomics)
About This Section

TryGeneCards Plus
RefSeq DNA sequence at NCBI GenBank:
NC_000006.11  NC_018917.2  NT_007592.16  
Regulatory elements:
   Regulatory transcription factor binding sites in the RPP40 gene promoter:
         RFX1   GATA-3   Pbx1a   NCX/Ncx   Pax-2   Pax-2a   POU3F2 (N-Oct-5a)   POU3F2 (N-Oct-5b)   POU3F2   Gfi-1   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidRPP40 promoter sequence
   Search Chromatin IP Primers for RPP40

Epigenetics:
DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat RPP40


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 6p25.1   Ensembl cytogenetic band:  6p25.1   HGNC cytogenetic band: 6p25.1

RPP40 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
RPP40 gene location

GeneLoc information about chromosome 6         GeneLoc Exon Structure

GeneLoc location for GC06M004942:  view genomic region     (about GC identifiers)

Start:
4,994,966 bp from pter      End:
5,004,297 bp from pter
Size:
9,332 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, 2neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, Cloud-Clone Corp., and/or eBioscience,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, Cloud-Clone Corp., and/or eBioscience, Antibodies by EMD Millipore, R&D Systems, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, Cloud-Clone Corp, and/or others.)
About This Section

TryGeneCards Plus

UniProtKB/Swiss-Prot: RPP40_HUMAN, O75818 (See protein sequence)
Recommended Name: Ribonuclease P protein subunit p40  
Size: 363 amino acids; 41834 Da
Subunit: RNase P consists of an RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25,
RPP29/POP4, RPP30, RPP38 and RPP40
Sequence caution: Sequence=AAC24114.1; Type=Erroneous initiation; Sequence=AAH17871.1; Type=Frameshift;
Positions=327; Sequence=CAH73740.1; Type=Erroneous initiation;
Secondary accessions: Q5VX97 Q8WVK8
Alternative splicing: 2 isoforms:  O75818-1   O75818-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for RPP40: NX_O75818

Explore proteomics data for RPP40 at MOPED

Post-translational modifications: 

  • Modification sites at neXtProt
  • Modification sites at PhosphoSitePlus
  • 3 DME Specific Peptides for RPP40 (O75818)
     DYWLQMAVGA  FKEKKPLKFDFLLAWH  IDEDNTVALLPNGKLILSLDKDTYEETGLQG 


    See RPP40 Protein Expression from SPIRE MOPED, PaxDB, and MaxQB

    REFSEQ proteins (3 alternative transcripts): 
    NP_001273061.1  NP_001273062.1  NP_006629.2  

    ENSEMBL proteins: 
     ENSP00000369391   ENSP00000317998   ENSP00000419431   ENSP00000418874  

    RPP40 Human Recombinant Protein Products:

    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    OriGene Purified Protein for RPP40
    OriGene Protein Over-expression Lysate for RPP40
    OriGene MassSpec for RPP40
    OriGene Custom Protein Services for RPP40
    GenScript Custom Purified and Recombinant Proteins Services for RPP40
    Novus Biologicals RPP40 Proteins
    Novus Biologicals RPP40 Lysates
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates
    Browse ProSpec Recombinant Proteins
    Browse Proteins at Cloud-Clone Corp.

     
    Search eBioscience for Proteins for RPP40 

    RPP40 Antibody Products:

    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for RPP40
    Novus Biologicals RPP40 Antibodies
    Abcam antibodies for RPP40
    Browse Antibodies at Cloud-Clone Corp.
    Search ThermoFisher Antibodies for RPP40
    Search LSBio for Antibodies for RPP40

    RPP40 Assay Products:

    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for RPP40
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for RPP40
    Browse Enzo Life Sciences for kits & assays
    Browse ELISAs at Cloud-Clone Corp.
    Browse CLIAs at Cloud-Clone Corp.
    Search eBioscience for ELISAs for RPP40 


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    TryGeneCards Plus
    1 InterPro protein domain:
     IPR013893 RNase_P_Rpp40

    Graphical View of Domain Structure for InterPro Entry O75818

    ProtoNet protein and cluster: O75818


    Find genes that share domains with RPP40           About GenesLikeMe


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    transcription factor targeting from QIAGEN and/or HOMER, miRNA Gene Targets from miRTarBase, shRNA from OriGene, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, SwitchGear Genomics, Gene Editing from DNA2.0, Clones from OriGene, GenScript, Sino Biological, DNA2.0, Vector BioLabs and/or Addgene, Cell Lines from GenScript, ESI BIO, In Situ Hybridization Assays from Advanced Cell Diagnostics, Flow cytometry from eBioscience, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: RPP40_HUMAN, O75818
    Function: Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their
    5'-ends
    Catalytic activity: Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor

         Enzyme Number (IUBMB): EC 3.1.26.51 2

         Gene Ontology (GO): 1 molecular function term:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004526ribonuclease P activity IEA--
         
    Find genes that share ontologies with RPP40           About GenesLikeMe


    Animal Models:
       inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for RPP40
       inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for RPP40

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for RPP40
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for RPP40

    miRNA
    Products:
        
    miRTarBase miRNAs that target RPP40:
    hsa-mir-30a-5p (MIRT028558), hsa-mir-1 (MIRT023880)

    Block miRNA regulation of human, mouse, rat RPP40 using miScript Target Protectors
    Search for qRT-PCR Assays for microRNAs that regulate RPP40
    Browse SwitchGear 3'UTR luciferase reporter plasmids
    Inhib. RNA
    Products:
        
    OriGene RNAi products in human, mouse, rat for RPP40
    Predesigned siRNA for gene silencing in human, mouse, rat RPP40

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for RPP40

    Clone
    Products:
         
    OriGene clones in human, mouse for RPP40 (see all 5)
    OriGene ORF clones in mouse, rat for RPP40
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: RPP40 (NM_006638)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for RPP40
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat RPP40

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for RPP40
    Browse ESI BIO Cell Lines and PureStem Progenitors for RPP40 
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for RPP40


    (According to UniProtKB, COMPARTMENTS Subcellular localization database, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Subcellular locations from UniProtKB/Swiss-Prot
    RPP40_HUMAN, O75818: Nucleus, nucleolus (Potential)
    Subcellular locations from COMPARTMENTS: 

    CompartmentConfidence
    nucleus4
    cytosol2
    peroxisome1

    Gene Ontology (GO): 2 cellular component terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005634nucleus TAS9630247
    GO:0005655nucleolar ribonuclease P complex TAS9630247

    Find genes that share ontologies with RPP40           About GenesLikeMe


    (SuperPaths according to PathCards, Pathways according to R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to QIAGEN, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene).
    About This Section

    TryGeneCards Plus

    SuperPaths for RPP40 About    
    See pathways by source

    SuperPathContained pathways About
    1RNA transport
    RNA transport
    2Ribosome biogenesis in eukaryotes
    Ribosome biogenesis in eukaryotes


    Find genes that share SuperPaths with RPP40           About GenesLikeMe

    Pathways by source                                                                                                                                                                 See SuperPaths
    Show all pathways



    2 Kegg Pathways  (Kegg details for RPP40):
        Ribosome biogenesis in eukaryotes
    RNA transport

        Custom Pathway & Disease-focused RT2 Profiler PCR Arrays for RPP40
    Interactions:

        Search GeneGlobe Interaction Network for RPP40

    STRING Interaction Network Preview (showing 5 interactants - click image to see 7)

    Selected Interacting proteins for RPP40 (O758183 ENSP000003693914) via UniProtKB, MINT, STRING, and/or I2D (see all 13)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    RPP21Q9H6333, ENSP000004038334I2D: score=3 STRING: ENSP00000403833
    ENSG00000239865Q9H6333I2D: score=3 
    ENSG00000239927Q9H6333I2D: score=3 
    ENSG00000241779Q9H6333I2D: score=3 
    ENSG00000241863Q9H6333I2D: score=3 
    About this table

    Gene Ontology (GO): 3 biological process terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0008033tRNA processing IEA--
    GO:0090501RNA phosphodiester bond hydrolysis TAS9630247
    GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic TAS9630247

    Find genes that share ontologies with RPP40           About GenesLikeMe



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience, ApexBio, HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB)
    About This Section

    TryGeneCards Plus
    Browse Small Molecules at EMD Millipore
       Browse drugs & compounds from Enzo Life Sciences
      Browse compounds at ApexBio 

    Browse Tocris compounds for RPP40



    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN, SwitchGear Genomics,
    Tagged/untagged cDNA clones from OriGene, GenScript, DNA2.0, Vector BioLabs, and/or Addgene, Primers from OriGene, and/or QIAGEN, Flow cytometry from eBioscience )
    About This Section

    TryGeneCards Plus

    REFSEQ mRNAs for RPP40 gene (3 alternative transcripts): 
    NM_001286132.1  NM_001286133.1  NM_006638.3  

    Unigene Cluster for RPP40:

    Ribonuclease P/MRP 40kDa subunit
    Hs.511756  [show with all ESTs]
    Unigene Representative Sequence: NM_006638
    6 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000380051(uc003mwl.3 uc003mwm.3) ENST00000319533 ENST00000464646
    ENST00000468105 ENST00000479782 ENST00000483546
    miRNA
    Products:
         
    Block miRNA regulation of human, mouse, rat RPP40 using miScript Target Protectors
    Search for qRT-PCR Assays for microRNAs that regulate RPP40
    Browse SwitchGear 3'UTR luciferase reporter plasmids
    Inhib. RNA
    Products:
         
    OriGene RNAi products in human, mouse, rat for RPP40
    Predesigned siRNA for gene silencing in human, mouse, rat RPP40
    Clone
    Products:
         
    OriGene clones in human, mouse for RPP40 (see all 5)
    OriGene ORF clones in mouse, rat for RPP40
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: RPP40 (NM_006638)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for RPP40
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat RPP40
    Primer
    Products:
        
    OriGene qPCR primer pairs and template standards for RPP40
    OriGene qSTAR qPCR primer pairs in human, mouse for RPP40
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat RPP40
      QuantiTect SYBR Green Assays in human, mouse, rat RPP40
      QuantiFast Probe-based Assays in human, mouse, rat RPP40

    Additional mRNA sequence: BC017871.1 

    4 DOTS entries:

    DT.100776861  DT.451896  DT.121375746  DT.95369097 

    Selected AceView cDNA sequences (see all 69):

    AI475313 BE549407 BU632308 AA961460 BU607286 CR590977 CB146897 BQ220155 
    BU520935 AI334027 BE042811 AA716445 BX099909 BI826512 AI762114 AA534913 
    AA643368 CA436784 AW089080 CA424123 AI208790 BQ015575 BC017871 BF980265 

    GeneLoc Exon Structure

    4 Alternative Splicing Database (ASD) splice patterns (SP) for RPP40    About this scheme

    ExUns: 1a · 1b · 1c ^ 2a · 2b · 2c ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8
    SP1:                                -     -                                 
    SP2:                                -                                       
    SP3:                                -                                       
    SP4:                                                                        


    ECgene alternative splicing isoforms for RPP40

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MaxQB, plus additional links to SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from QIAGEN, Primers from OriGene, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TryGeneCards Plus

    RPP40 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: GTTTTCGAAA
    RPP40 Expression
    About this image

    RPP40 Protein expression data from MOPED1, PaxDb2 and MaxQB3    About this image

    RPP40 Protein Expression

    SOURCE GeneReport for Unigene cluster: Hs.511756
        Custom PCR Arrays for RPP40
    Primer
    Products:
    OriGene qPCR primer pairs and template standards for RPP40
    OriGene qSTAR qPCR primer pairs in human, mouse for RPP40
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat RPP40
    QuantiTect SYBR Green Assays in human, mouse, rat RPP40
    QuantiFast Probe-based Assays in human, mouse, rat RPP40
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for RPP40

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    TryGeneCards Plus

    This gene was present in the common ancestor of chordates.

    Orthologs for RPP40 gene from Selected species (see all 12)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Rpp401 , 5 ribonuclease P 40 subunit (human)5
    ribonuclease P 40 subunit1
    84.57(n)1
    84.3(a)1
      13 (14.44 cM)5
    2083661  NM_145938.41  NP_666050.31 
     358934725 
    chicken
    (Gallus gallus)
    Aves RPP401 ribonuclease P/MRP 40kDa subunit 69.54(n)
    65.28(a)
      420876  XM_418963.3  XP_418963.1 
    lizard
    (Anolis carolinensis)
    Reptilia RPP406
    ribonuclease P/MRP 40kDa subunit
    55(a)
    1 ↔ 1
    GL344476.1(12919-27489)
    African clawed frog
    (Xenopus laevis)
    Amphibia Xl.70162 Xenopus laevis transcribed sequence with weak similarity more 73.78(n)    AW640395.1 
    zebrafish
    (Danio rerio)
    Actinopterygii rpp401 ribonuclease P 40 subunit 58.52(n)
    50.28(a)
      415238  NM_001002148.1  NP_001002148.1 


    ENSEMBL Gene Tree for RPP40 (if available)
    TreeFam Gene Tree for RPP40 (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section

    TryGeneCards Plus
    Paralogs for RPP40 gene

    Find genes that share paralogs with RPP40           About GenesLikeMe


    5 Pseudogenes.org Pseudogenes for RPP40
    PGOHUM00000258725 PGOHUM00000237304 PGOHUM00000247586 PGOHUM00000243629 PGOHUM00000241214


    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD), the Human Cytochrome P450 Allele Nomenclature Database, and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers, Cancer Mutation PCR Arrays and Assays, and Copy Number PCR Arrays from QIAGEN)
    About This Section

    TryGeneCards Plus

    Selected SNPs for RPP40 (see all 327)    About this table                                 

    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 6 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs733543381,2
    C,F--4994782(+) TTAGCG/TTGAGA 1 -- ds50011Minor allele frequency- T:0.50WA 2
    rs1413832301,2
    C--4994907(+) TCTAAC/TATGGT 1 -- ds50010--------
    rs2002791581,2
    C--4994962(+) GAGAT-/TTCTTCTT 1 -- cds10--------
    rs12469851,2
    C,F,A,H--4995017(+) AATGGG/AGTGAG 1 -- ds500117Minor allele frequency- A:0.37NS EA NA WA CSA 826
    rs1166375411,2
    C--4995041(+) TCCCCA/GGTCCC 1 -- ds50010--------
    rs12719701,2
    C,F,O,A,H--4995072(+) ACCACG/ATAGTA 1 -- ds500131Minor allele frequency- A:0.39NS EA NA WA CSA 2854
    rs785930121,2
    F--4995116(+) AATCAA/CCTATG 1 -- ds50011Minor allele frequency- C:0.05NA 120
    rs12469861,2
    C,F,O,A,H--4995132(+) TTCACT/GGGACA 1 -- ds500115Minor allele frequency- G:0.22NA EA WA CSA 866
    rs1469517641,2
    --4995224(+) ACACAA/GGCCTG 1 -- ds50010--------
    rs623851171,2
    C--4995275(+) CAAGCG/ATAAAT 1 -- ds50012Minor allele frequency- A:0.04NA EA 122

    HapMap Linkage Disequilibrium report for RPP40 (4994966 - 5004297 bp)

    Structural Variations
         Database of Genomic Variants (DGV) 4 variations for RPP40:    About this table    
    Variant IDTypeSubtypePubMed ID
    esv2668988CNV Deletion23128226
    esv2422499CNV Duplication17116639
    nsv830577CNV Loss17160897
    nsv462622CNV Gain19166990

    Site Specific Mutation Identification with PCR Assays
    SeqTarget long-range PCR primers for resequencing RPP40
    DNA2.0 Custom Variant and Variant Library Synthesis for RPP40

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    TryGeneCards Plus
    OMIM gene information: 606117    OMIM disorders: --


    Find genes that share disorders with RPP40           About GenesLikeMe

    Genetic Association Database (GAD): RPP40

    Export disorders for RPP40 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    TryGeneCards Plus

    PubMed articles for RPP40 gene, integrated from 10 sources (see all 14):
    (articles sorted by number of sources associating them with RPP40)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Autoantigenic properties of some protein subunits of catalytically active complexes of human ribonuclease P. (PubMed id 9630247)1, 2, 3, 9 Jarrous N.... Altman S. (RNA 1998)
    2. A census of human soluble protein complexes. (PubMed id 22939629)1 Havugimana P.C....Emili A. (Cell 2012)
    3. A high-throughput approach for measuring temporal changes in the interactome. (PubMed id 22863883)1 Kristensen A.R....Foster L.J. (Nat. Methods 2012)
    4. Mass spectrometric analysis of lysine ubiquitylation reveals promiscuity at site level. (PubMed id 21139048)1 Danielsen J.M....Nielsen M.L. (amp 2011)
    5. Global identification of modular cullin-RING ligase substrates. (PubMed id 21963094)1 Emanuele M.J....Elledge S.J. (Cell 2011)
    6. Viperin mRNA is a novel target for the human RNase MRP/RNase P endoribonuclease. (PubMed id 21053045)1 Mattijssen S....Pruijn G.J. (Cell. Mol. Life Sci. 2011)
    7. A genome-wide short hairpin RNA screening of jurkat T-cells for human proteins contributing to productive HIV-1 replication. (PubMed id 19460752)1 Yeung M.L....Jeang K.T. (J. Biol. Chem. 2009)
    8. Transcriptome analysis of human gastric cancer. (PubMed id 16341674)1 Oh J.H.... Kim N.S. (Mamm. Genome 2005)
    9. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)2 Gerhard D.S.... Malek J. (Genome Res. 2004)
    10. Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex. (PubMed id 15096576)1 Welting T.J.... Pruijn G.J. (Nucleic Acids Res. 2004)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section

    TryGeneCards Plus
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section

    TryGeneCards Plus
    Entrez Gene: 10799 HGNC: 20992 AceView: RPP40 Ensembl:ENSG00000124787 euGenes: HUgn10799
    ECgene: RPP40 Kegg: 10799 H-InvDB: RPP40

    (According to HUGE)
    About This Section

    TryGeneCards Plus
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL, and/or others, e.g. Wikipedia and GeneReviews, via UniProtKB/Swiss-Prot)
    About This Section

    TryGeneCards Plus
    NameDescription
    PharmGKB entry for RPP40 Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section

    TryGeneCards Plus
    Patent Information for RPP40 gene:
    Search GeneIP for patents involving RPP40

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, eBioscience, and/or others, Gene Editing from DNA2.0. Clones from OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Addgene, Cell lines from GenScript, and ESI BIO, Flow cytometery from eBioscience, PCR Arrays from QIAGEN, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, Enzo Life Sciences, and/or ApexBio, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

    TryGeneCards Plus

     
     EMD Millipore genomic analysis products

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Enzyme Activity Assays/Reagents  
     Browse ELISpot/FluoroSpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Luminex Assays  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Recombinant/Natural Proteins   Browse Stem Cell Products  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     Browse OriGene Antibodies   OriGene RNAi products in human, mouse, rat for RPP40  
     OriGene qPCR primer pairs and template standards for RPP40   OriGene Protein Over-expression Lysate for RPP40  
     OriGene MassSpec something-or-other for RPP40   OriGene clones in human, mouse for RPP40  
     OriGene qSTAR qPCR primer pairs in human, mouse for RPP40   OriGene Purified Protein for RPP40  
     OriGene ORF clones in mouse, rat for RPP40   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for RPP40   OriGene Custom Protein Services for RPP40  

     
     
     Block miRNA regulation of human, mouse, rat RPP40 using miScript Target Protectors SeqTarget long-range PCR primers for resequencing RPP40
     DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat RPP40 Predesigned siRNA for gene silencing in human, mouse, rat RPP40
     QuantiFast Probe-based Assays in human, mouse, rat RPP40 QuantiTect SYBR Green Assays in human, mouse, rat RPP40
     Custom PCR Arrays for RPP40 Search Chromatin IP Primers for RPP40
     Pre-validated RT2 qPCR Primer Assay in human, mouse, rat RPP40  Search GeneGlobe Interaction Network for RPP40
     Regulatory tfbs in RPP40 promoter
     GenScript Custom Purified and Recombinant Proteins Services for RPP40 GenScript cDNA clones with any tag delivered in your preferred vector for RPP40
     GenScript Custom Assay Services for RPP40 GenScript Custom overexpressing Cell Line Services for RPP40
     CloneReady with Over 120,000 Genes  Gene Synthesis: Any Gene in Any Vector
     Vector-based siRNA and miRNA, Ready for Transfection Gene Mutant Library, Variants up to 10^11
     Plasmid Preparation Custom Peptide Services
     Search for Antibodies & Assays

     Search Tocris compounds for RPP40
     Browse Sino Biological Proteins
     Browse Sino Biological Cell Lysates
     Browse Sino Biological cDNA Clones
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies

     Novus Tissue Slides
     RPP40 antibodies
     RPP40 proteins
     RPP40 lysates
     Antibodies for RPP40
     See all of Abcam's Antibodies, Kits and Proteins for RPP40
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins
     Browse Proteins at Cloud-Clone Corp.
     Browse Antibodies at Cloud-Clone Corp.
     Browse ELISAs at Cloud-Clone Corp.
     Browse CLIAs at Cloud-Clone Corp.



     Browse ESI BIO Cell Lines and PureStem Progenitors for RPP40
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for RPP40
     Browse SwitchGear 3'UTR luciferase reporter plasmids for RPP40
     SwitchGear Promoter luciferase reporter plasmids for RPP40
     Search ThermoFisher Antibodies for RPP40
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat RPP40
     inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for RPP40
     inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for RPP40
     Search LSBio for Antibodies for RPP40
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
     Browse compounds at ApexBio
     Search Addgene for plasmids for RPP40
      Search eBioscience for proteins for RPP40
      Search eBioscience for elisas for RPP40
      eBioscience FlowRNA Probe Sets
           
    GeneCards Homepage - Last full update: 7 May 2014 - Incrementals: 9 May 2014 , 2 Jun 2014 , 26 Jun 2014 , 30 Jun 2014 , 21 Aug 2014 , 8 Sep 2014

    View Random Gene

    Category
    (GIFtS: )
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      RPP40 gene at Home site.
    Version: 3.12.224 13 Oct 2014
    hostname: 356980-web2.xennexinc.com index build: 128 solr: 1.4