Free for academic non-profit institutions. Other users need a Commercial license

Aliases for ROCK2 Gene

Aliases for ROCK2 Gene

  • Rho Associated Coiled-Coil Containing Protein Kinase 2 2 3 5
  • Rho-Associated, Coiled-Coil-Containing Protein Kinase II 3 4
  • P164 ROCK-2 3 4
  • EC 2.7.11.1 4 61
  • ROCK-II 3 4
  • Rho-Associated, Coiled-Coil-Containing Protein Kinase 2 4
  • Rho-Associated Protein Kinase 2 3
  • Rho Kinase 2 4
  • EC 2.7.11 61
  • KIAA0619 4

External Ids for ROCK2 Gene

Previous GeneCards Identifiers for ROCK2 Gene

  • GC02M011106
  • GC02M011371
  • GC02M011343
  • GC02M011272
  • GC02M011319

Summaries for ROCK2 Gene

Entrez Gene Summary for ROCK2 Gene

  • The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is an isozyme of ROCK1 is a target for the small GTPase Rho. [provided by RefSeq, Jul 2008]

GeneCards Summary for ROCK2 Gene

ROCK2 (Rho Associated Coiled-Coil Containing Protein Kinase 2) is a Protein Coding gene. Diseases associated with ROCK2 include Corticobasal Degeneration and Sexual Disorder. Among its related pathways are Vascular smooth muscle contraction and Cytoskeleton remodeling Regulation of actin cytoskeleton by Rho GTPases. GO annotations related to this gene include poly(A) RNA binding and protein kinase activity. An important paralog of this gene is ROCK1.

UniProtKB/Swiss-Prot for ROCK2 Gene

  • Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Plays an important role in generating the circadian rhythm of the aortic myofilament Ca(2+) sensitivity and vascular contractility by modulating the myosin light chain phosphorylation.

Tocris Summary for ROCK2 Gene

  • Rho-kinases (aka Rho-associated coiled-coil kinases or ROCKs) are serine/threonine kinases activated by RhoA GTPases. They are modulators of processes involving cytoskeletal rearrangement such as focal adhesion formation, cell motility and tumor cell invasion.

No data available for CIViC summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for ROCK2 Gene

Genomics for ROCK2 Gene

Regulatory Elements for ROCK2 Gene

Enhancers for ROCK2 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH02G011373 1.8 FANTOM5 Ensembl ENCODE dbSUPER 17.9 -26.5 -26525 3.6 HDGF FOXA2 ARID4B SIN3A YBX1 ZNF48 FOS MXD4 NFIL3 SMARCA4 ROCK2 PQLC3 KCNF1 ENSG00000230952 ENSG00000231403
GH02G011369 1.5 Ensembl ENCODE dbSUPER 18 -22.7 -22663 2.6 FOXA2 MLX ZFP64 ARID4B DMAP1 ZNF48 YY1 SLC30A9 FOS SP5 ROCK2 PQLC3 ENSG00000230952 ENSG00000231403
GH02G011368 1.1 Ensembl ENCODE dbSUPER 18.5 -20.2 -20171 1.0 GATAD2A NFIC NFIA RNF2 MAX RAD21 YY1 ROCK2 PQLC3 ENSG00000230952 ENSG00000231403
GH02G011391 1.7 FANTOM5 Ensembl ENCODE dbSUPER 11.2 -43.7 -43668 1.6 PKNOX1 ARID4B SIN3A ZNF48 FOS ZNF263 ZHX2 ZNF592 SREBF1 ZNF579 LINC00570 ROCK2 NTSR2 C2orf50 KCNF1 ENSG00000231403
GH02G011403 1.5 Ensembl ENCODE dbSUPER 11.9 -57.4 -57369 4.9 FOXA2 ATF1 ARID4B ZNF48 FOS SP5 ZHX2 NFYC PPARG KAT8 ROCK2 LOC105373429 LINC00570
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around ROCK2 on UCSC Golden Path with GeneCards custom track

Genomic Location for ROCK2 Gene

Chromosome:
2
Start:
11,179,761 bp from pter
End:
11,348,330 bp from pter
Size:
168,570 bases
Orientation:
Minus strand

Genomic View for ROCK2 Gene

Genes around ROCK2 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
ROCK2 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for ROCK2 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for ROCK2 Gene

Proteins for ROCK2 Gene

  • Protein details for ROCK2 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O75116-ROCK2_HUMAN
    Recommended name:
    Rho-associated protein kinase 2
    Protein Accession:
    O75116
    Secondary Accessions:
    • Q53QZ0
    • Q53SJ7
    • Q9UQN5

    Protein attributes for ROCK2 Gene

    Size:
    1388 amino acids
    Molecular mass:
    160900 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homodimer. Interacts with IRS1, RHOB and RHOC (By similarity). Interacts with RHOA (activated by GTP), PPP1R12A, CHORDC1, SORL1, EP300 and BRCA2. Interacts with NPM1 and this interaction enhances its activity. Interacts with RAF1 (By similarity).
    SequenceCaution:
    • Sequence=AAX93049.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=BAA31594.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for ROCK2 Gene

neXtProt entry for ROCK2 Gene

Selected DME Specific Peptides for ROCK2 Gene

O75116:
  • AKNLICAFLTDREVRLGRNGVEEI
  • GTPDYISPE
  • SAAAIKAQFEKQLL
  • FKPPPALEC
  • GHLKLADFGTCMKM
  • ELQDQLEAEQYFSTLYKTQV
  • IFQILYANEGE
  • KVIGRGAF
  • EMLVGDTPFYADSLVGTYSKIM
  • KVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQL
  • IHRDVKPDN
  • CDTAVGTPDYISPEVLKSQGGDG
  • MVLDIDKLFHVRPVTQ
  • YLYMVMEYMPGGDLVNLMSNYDVPEKWA
  • HKGHEFIPTLYHFP
  • KEKENRKL
  • LKDQLEDL
  • LLRTESDTA
  • LPFIGFT
  • ERTLKTQAVNKLAEIMNRK
  • ETFPIPKAFVGNQLPF
  • DLDFPALRKNKNIDNFL
  • EQDKEQS
  • FYTAEVVLALDAIHSMG
  • SDIEQLR
  • FFKNDQW
  • LKQSQQK
  • VSSKKILFY
  • NMEIDMTYQLKVIQQSLEQEE

Post-translational modifications for ROCK2 Gene

  • Cleaved by granzyme B during apoptosis. This leads to constitutive activation of the kinase and membrane blebbing.
  • Phosphorylation at Tyr-722 reduces its binding to RHOA and is crucial for focal adhesion dynamics. Dephosphorylation by PTPN11 stimulates its RHOA binding activity.
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for ROCK2 (ROCK2)

Domains & Families for ROCK2 Gene

Suggested Antigen Peptide Sequences for ROCK2 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O75116

UniProtKB/Swiss-Prot:

ROCK2_HUMAN :
  • An interaction between Thr-414 and Asp-48 is essential for kinase activity and dimerization.
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Domain:
  • An interaction between Thr-414 and Asp-48 is essential for kinase activity and dimerization.
Family:
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
genes like me logo Genes that share domains with ROCK2: view

Function for ROCK2 Gene

Molecular function for ROCK2 Gene

GENATLAS Biochemistry:
serine/threonine kinase ROCK2/rho kinase,isozyme of ROCK1,one the targets for the small GTPase Rho,putative mediator of the Rho-dependent signaling pathway
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by RHOA binding. Inhibited by Y-27632 (By similarity).
UniProtKB/Swiss-Prot Function:
Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Plays an important role in generating the circadian rhythm of the aortic myofilament Ca(2+) sensitivity and vascular contractility by modulating the myosin light chain phosphorylation.

Enzyme Numbers (IUBMB) for ROCK2 Gene

Gene Ontology (GO) - Molecular Function for ROCK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003723 RNA binding IDA 22681889
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IDA,IEA 16574662
GO:0005198 structural molecule activity NAS 9933571
GO:0005515 protein binding IPI 17015463
genes like me logo Genes that share ontologies with ROCK2: view
genes like me logo Genes that share phenotypes with ROCK2: view

Animal Models for ROCK2 Gene

MGI Knock Outs for ROCK2:

Animal Model Products

  • Taconic Biosciences Mouse Models for ROCK2

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ROCK2

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for ROCK2 Gene

Localization for ROCK2 Gene

Subcellular locations from UniProtKB/Swiss-Prot for ROCK2 Gene

Cytoplasm. Cell membrane; Peripheral membrane protein. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Note=Cytoplasmic, and associated with actin microfilaments and the plasma membrane. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for ROCK2 gene
Compartment Confidence
cytoskeleton 5
nucleus 5
cytosol 5
plasma membrane 4
extracellular 1
mitochondrion 1

Gene Ontology (GO) - Cellular Components for ROCK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IEA --
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
GO:0005813 centrosome IDA 17015463
GO:0005815 microtubule organizing center IEA --
genes like me logo Genes that share ontologies with ROCK2: view

Pathways & Interactions for ROCK2 Gene

genes like me logo Genes that share pathways with ROCK2: view

Pathways by source for ROCK2 Gene

SIGNOR curated interactions for ROCK2 Gene

Activates:
Inactivates:

Gene Ontology (GO) - Biological Process for ROCK2 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000910 cytokinesis NAS 9933571
GO:0001934 positive regulation of protein phosphorylation IMP 24065547
GO:0006468 protein phosphorylation IDA,IEA 18559669
GO:0006939 smooth muscle contraction IEA,TAS 12778124
GO:0007249 I-kappaB kinase/NF-kappaB signaling IMP 25816133
genes like me logo Genes that share ontologies with ROCK2: view

Drugs & Compounds for ROCK2 Gene

(33) Drugs for ROCK2 Gene - From: DrugBank, ApexBio, DGIdb, HMDB, and Tocris

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Ripasudil Approved Pharma Target, Inhibitor 0
Adenosine triphosphate Approved Nutra 0
(R)-TRANS-4-(1-AMINOETHYL)-N-(4-PYRIDYL) CYCLOHEXANECARBOXAMIDE Experimental Pharma Target 0
Hydroxyfasudil Experimental Pharma Rho-kinase inhibitor and vasodilator 0
Guanosine triphosphate Experimental Pharma 0

(8) Additional Compounds for ROCK2 Gene - From: HMDB and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
Diglycerides Group A
  • 1,2-Dimyristoyl-rac-glycerol
  • DAG(14:0/14:0)
  • DAG(28:0)
  • DG(14:0/14:0)
  • DG(28:0)
Diglycerides Group B
  • 1-Palmitoleoyl-2-arachidonyl-sn-glycerol
  • DAG(16:1/20:0)
  • DAG(16:1n7/20:0)
  • DAG(16:1w7/20:0)
  • DAG(36:1)
Diglycerides Group C
  • 1-Hexadecanoyl-3-(11-eicosenoyl)-sn-glycerol
  • 1-Palmitoyl-3-eicosenoyl-sn-glycerol
  • DAG(16:0/0:0/20:1)
  • DAG(16:0/0:0/20:1n9)
  • DAG(16:0/0:0/20:1w9)
Diglycerides Group D
  • 1,2-Didocosahexaenoyl-rac-glycerol
  • DAG(22:6/22:6)
  • DAG(22:6n3/22:6n3)
  • DAG(22:6w3/22:6w3)
  • DAG(44:12)

(5) Tocris Compounds for ROCK2 Gene

Compound Action Cas Number
Fasudil hydrochloride Inhibitor of cyclic nucleotide dependent- and Rho-kinases 105628-07-7
GSK 269962 Potent and selective ROCK inhibitor 850664-21-0
GSK 429286 Selective Rho-kinase (ROCK) inhibitor 864082-47-3
H 1152 dihydrochloride Selective Rho-kinase (ROCK) inhibitor 871543-07-6
Y-27632 dihydrochloride Selective p160ROCK inhibitor 129830-38-2

(25) ApexBio Compounds for ROCK2 Gene

Compound Action Cas Number
AS 1892802 ROCK inhibitor,potent and ATP-competitive 928320-12-1
chroman 1 ROCK II inhibitor, highly potent and selective 1273579-40-0
Fasudil calcium antagonist 103745-39-7
Fasudil (HA-1077) HCl Protein kinase inhibitor 105628-07-7
GSK269962A ROCK inhibitor 850664-21-0
GSK429286A Selective ROCK1/ROCK2 inhibitor 864082-47-3
H-1152 Rho-kinase inhibitor 451462-58-1
H-1152 dihydrochloride Rho-kinase inhibitor 871543-07-6
Hydroxyfasudil Rho-kinase inhibitor and vasodilator 105628-72-6
Hydroxyfasudil hydrochloride Rho-kinase inhibitor and vasodilator 155558-32-0
K-115 887375-67-9
K-115 free base 223645-67-8
LX7101 HCL Dual LIM-kinase and ROCK inhibitor 1192189-69-7
Narciclasine Modulates the Rho/ROCK/LIM kinase/cofilin pathway 29477-83-6
RKI-1447 Potent ROCK1/ROCK2 inhibitor 1342278-01-6
ROCK inhibitor ROCK-1/ROCK-2 inhibitor,highly potent 867017-68-3
SAR407899 923359-38-0
SAR407899 hydrochloride 923262-96-8
SB 772077B dihydrochloride 607373-46-6
SLx-2119 Selective ROCK2 inhibitor 911417-87-3
SR-3677 Rho Kinase (ROCK-II) inhibitor 1072959-67-1
Thiazovivin ROCK inhibitor 1226056-71-8
Y-27632 ROCK inhibitor,potent and selective 146986-50-7
Y-27632 dihydrochloride ROCK1 inhibitor 146986-50-7, 129830-38-2
Y-39983 dihydrochloride ROCK family inhibitor 173897-44-4
genes like me logo Genes that share compounds with ROCK2: view

Drug Products

Transcripts for ROCK2 Gene

Unigene Clusters for ROCK2 Gene

Rho-associated, coiled-coil containing protein kinase 2:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for ROCK2

Alternative Splicing Database (ASD) splice patterns (SP) for ROCK2 Gene

No ASD Table

Relevant External Links for ROCK2 Gene

GeneLoc Exon Structure for
ROCK2
ECgene alternative splicing isoforms for
ROCK2

Expression for ROCK2 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for ROCK2 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for ROCK2 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (18.4), Platelet (8.6), and Heart (7.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for ROCK2 Gene



Protein tissue co-expression partners for ROCK2 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of ROCK2 Gene:

ROCK2

SOURCE GeneReport for Unigene cluster for ROCK2 Gene:

Hs.681743

Evidence on tissue expression from TISSUES for ROCK2 Gene

  • Nervous system(4.7)
  • Liver(4.5)
  • Muscle(3.2)
  • Heart(2.9)
  • Blood(2.8)
  • Eye(2.6)
  • Lung(2.6)
  • Intestine(2)
  • Kidney(2)
  • Spleen(2)
genes like me logo Genes that share expression patterns with ROCK2: view

Primer Products

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for ROCK2 Gene

Orthologs for ROCK2 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for ROCK2 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia ROCK2 34 35
  • 99.83 (n)
cow
(Bos Taurus)
Mammalia ROCK2 34 35
  • 93.52 (n)
dog
(Canis familiaris)
Mammalia ROCK2 34 35
  • 92.17 (n)
mouse
(Mus musculus)
Mammalia Rock2 34 16 35
  • 91.04 (n)
rat
(Rattus norvegicus)
Mammalia Rock2 34
  • 90.73 (n)
oppossum
(Monodelphis domestica)
Mammalia ROCK2 35
  • 90 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia ROCK2 35
  • 88 (a)
OneToOne
chicken
(Gallus gallus)
Aves ROCK2 34 35
  • 83.16 (n)
lizard
(Anolis carolinensis)
Reptilia ROCK2 35
  • 84 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia rock2 34
  • 75.39 (n)
Str.15799 34
African clawed frog
(Xenopus laevis)
Amphibia rocka-A-prov 34
zebrafish
(Danio rerio)
Actinopterygii ROCK2 (6 of 10) 35
  • 81 (a)
OneToMany
ROCK2 (9 of 10) 35
  • 80 (a)
OneToMany
ROCK2 (4 of 10) 35
  • 79 (a)
OneToMany
ROCK2 (7 of 10) 35
  • 79 (a)
OneToMany
ROCK2 (3 of 10) 35
  • 78 (a)
OneToMany
ROCK2 (5 of 10) 35
  • 78 (a)
OneToMany
ROCK2 (8 of 10) 35