Free for academic non-profit institutions. Other users need a Commercial license

Aliases for RNF34 Gene

Aliases for RNF34 Gene

  • Ring Finger Protein 34 2 3
  • Human RING Finger Homologous To Inhibitor Of Apoptosis Protein 3 4
  • Ring Finger Protein 34, E3 Ubiquitin Protein Ligase 2 3
  • Caspases-8 And -10-Associated RING Finger Protein 1 3 4
  • RING Finger Protein RIFF 3 4
  • Caspase Regulator CARP1 3 4
  • RING Finger Protein 34 4 5
  • CARP-1 3 4
  • HRFI 3 4
  • E3 Ubiquitin-Protein Ligase RNF34 3
  • FYVE-RING Finger Protein MOMO 3
  • FYVE-RING Finger Protein Momo 4
  • EC 6.3.2.- 4
  • EC 6.3.2 61
  • CARP1 3
  • RIFF 3
  • RIF 3
  • RFI 3

External Ids for RNF34 Gene

Previous GeneCards Identifiers for RNF34 Gene

  • GC12P120717
  • GC12M121524
  • GC12P121621
  • GC12P120250
  • GC12P120251
  • GC12P120300
  • GC12P121837
  • GC12P118847

Summaries for RNF34 Gene

Entrez Gene Summary for RNF34 Gene

  • The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. This protein also targets p53 and phospho-p53 for degradation. Alternatively splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012]

GeneCards Summary for RNF34 Gene

RNF34 (Ring Finger Protein 34) is a Protein Coding gene. Among its related pathways are Immune System and Regulation of TP53 Expression and Degradation. GO annotations related to this gene include ligase activity and ubiquitin protein ligase binding. An important paralog of this gene is RFFL.

UniProtKB/Swiss-Prot for RNF34 Gene

  • E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis (PubMed:15069192). May mediate Lys-48-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway (Ref.13). Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation (PubMed:17121812). Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN (PubMed:18382127). Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through Lys-48-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation (PubMed:25012219).

Gene Wiki entry for RNF34 Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for RNF34 Gene

Genomics for RNF34 Gene

Regulatory Elements for RNF34 Gene

Enhancers for RNF34 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH12F121530 1.7 FANTOM5 Ensembl ENCODE 16.5 +134.6 134634 9.0 HDGF PKNOX1 MLX WRNIP1 ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 RNF34 KDM2B LOC101928346 MIR7107 ANAPC5 ENSG00000258435 P2RX4 SETD1B ORAI1 RHOF
GH12F121423 1.5 FANTOM5 Ensembl ENCODE 17.8 +25.1 25125 3.5 HDAC1 PKNOX1 ZNF335 ZNF766 GATA2 CBX5 CREM ZNF362 CBFB CEBPB RNF34 ENSG00000258435 ANAPC5 KDM2B LOC101928346
GH12F121351 1.2 ENCODE 12.3 -47.7 -47657 2.7 HDGF PKNOX1 ARNT CREB3L1 MLX ARID4B SIN3A DMAP1 ZNF2 YY1 ANAPC5 CAMKK2 LOC100506691 C12orf43 PSMD9 RNF34 SRSF9 SETD1B DYNLL1 ENSG00000272849
GH12F121364 1.1 Ensembl 12.4 -34.9 -34941 0.6 HDGF ATF1 PKNOX1 ARNT CREB3L1 ARID4B SIN3A DMAP1 ZNF2 ZNF48 ANAPC5 RNF34 LINC01089 MIR4700 VPS33A ENSG00000272849 ENSG00000258435 CAMKK2
GH12F121189 1.3 Ensembl ENCODE 10 -209.2 -209216 3.6 HDGF PKNOX1 ARID4B SIN3A GLIS2 FOS ZNF263 SP3 SP5 TBX21 P2RX7 ANAPC5 RNF34 P2RX4 ENSG00000274029 GC12M121199
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around RNF34 on UCSC Golden Path with GeneCards custom track

Promoters for RNF34 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000091475 259 3001 HDGF PKNOX1 CREB3L1 ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 CBX5

Genomic Location for RNF34 Gene

Chromosome:
12
Start:
121,400,041 bp from pter
End:
121,430,623 bp from pter
Size:
30,583 bases
Orientation:
Plus strand

Genomic View for RNF34 Gene

Genes around RNF34 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RNF34 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RNF34 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for RNF34 Gene

Proteins for RNF34 Gene

  • Protein details for RNF34 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q969K3-RNF34_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase RNF34
    Protein Accession:
    Q969K3
    Secondary Accessions:
    • B7Z933
    • Q8NG47
    • Q9H6W8

    Protein attributes for RNF34 Gene

    Size:
    372 amino acids
    Molecular mass:
    41641 Da
    Quaternary structure:
    • Interacts with CASP8 and CASP10. Interacts (via RING-type zinc finger) with PPARGC1A. Interacts with NOD1. Interacts with p53/TP53; involved in p53/TP53 ubiquitination. Interacts (via RING-type zinc finger) with MDM2; the interaction stabilizes MDM2.
    SequenceCaution:
    • Sequence=BAH14169.1; Type=Miscellaneous discrepancy; Note=Intron retention.; Evidence={ECO:0000305};

    Alternative splice isoforms for RNF34 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for RNF34 Gene

Selected DME Specific Peptides for RNF34 Gene

Q969K3:
  • SSRSQTSSFFT
  • QENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYL
  • IDCVLLECGHMVTCTKCGKRM
  • RMSECPICR
  • TGPFRFTP
  • GCCEKWEL
  • VRQLKEILARNFVNY

Post-translational modifications for RNF34 Gene

Domains & Families for RNF34 Gene

Gene Families for RNF34 Gene

Protein Domains for RNF34 Gene

Suggested Antigen Peptide Sequences for RNF34 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q969K3

UniProtKB/Swiss-Prot:

RNF34_HUMAN :
  • The RING-type zinc finger is required for the ubiquitination of target proteins.
  • Contains 1 FYVE-type zinc finger.
Domain:
  • The RING-type zinc finger is required for the ubiquitination of target proteins.
  • The FYVE-type zinc finger domain is required for localization and may confer affinity for cellular compartments enriched in phosphatidylinositol 5-phosphate and phosphatidylinositol 3-phosphate phospholipids.
  • Contains 2 SAP domains.
Similarity:
  • Contains 1 FYVE-type zinc finger.
  • Contains 1 RING-type zinc finger.
genes like me logo Genes that share domains with RNF34: view

Function for RNF34 Gene

Molecular function for RNF34 Gene

UniProtKB/Swiss-Prot Function:
E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis (PubMed:15069192). May mediate Lys-48-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway (Ref.13). Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation (PubMed:17121812). Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN (PubMed:18382127). Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through Lys-48-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation (PubMed:25012219).

Enzyme Numbers (IUBMB) for RNF34 Gene

Gene Ontology (GO) - Molecular Function for RNF34 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002039 p53 binding IPI 17121812
GO:0004842 ubiquitin-protein transferase activity TAS --
GO:0005515 protein binding IPI 15069192
GO:0008270 zinc ion binding IEA --
GO:0016874 ligase activity IEA --
genes like me logo Genes that share ontologies with RNF34: view
genes like me logo Genes that share phenotypes with RNF34: view

Animal Model Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for RNF34

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for RNF34 Gene

Localization for RNF34 Gene

Subcellular locations from UniProtKB/Swiss-Prot for RNF34 Gene

Cell membrane; Peripheral membrane protein. Endomembrane system; Peripheral membrane protein. Nucleus. Nucleus speckle. Cytoplasm, cytosol.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RNF34 gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 4
extracellular 2
mitochondrion 1

Gene Ontology (GO) - Cellular Components for RNF34 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 22064484
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IEA,IDA 15069192
GO:0005829 cytosol TAS --
GO:0005886 plasma membrane IEA,IDA 15069192
genes like me logo Genes that share ontologies with RNF34: view

Pathways & Interactions for RNF34 Gene

genes like me logo Genes that share pathways with RNF34: view

UniProtKB/Swiss-Prot Q969K3-RNF34_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for RNF34 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000209 protein polyubiquitination TAS --
GO:0006915 apoptotic process IEA --
GO:0016567 protein ubiquitination IMP 22064484
GO:0035872 nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway IMP 25012219
GO:0042787 protein ubiquitination involved in ubiquitin-dependent protein catabolic process IMP 22064484
genes like me logo Genes that share ontologies with RNF34: view

No data available for SIGNOR curated interactions for RNF34 Gene

Transcripts for RNF34 Gene

Unigene Clusters for RNF34 Gene

Ring finger protein 34, E3 ubiquitin protein ligase:
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for RNF34

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for RNF34 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9 ^ 10a · 10b · 10c
SP1: - - - - -
SP2: - - - - - - - -
SP3: - - - -
SP4: - -
SP5: - - -
SP6:
SP7: - - - - - - - -
SP8: - - -
SP9: - - - - - - - - - - -

Relevant External Links for RNF34 Gene

GeneLoc Exon Structure for
RNF34
ECgene alternative splicing isoforms for
RNF34

Expression for RNF34 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for RNF34 Gene

Protein differential expression in normal tissues from HIPED for RNF34 Gene

This gene is overexpressed in Peripheral blood mononuclear cells (31.6), Lung (19.5), and Testis (8.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for RNF34 Gene



Protein tissue co-expression partners for RNF34 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of RNF34 Gene:

RNF34

SOURCE GeneReport for Unigene cluster for RNF34 Gene:

Hs.292804

mRNA Expression by UniProt/SwissProt for RNF34 Gene:

Q969K3-RNF34_HUMAN
Tissue specificity: Ubiquitous. Detected in heart, brain, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, colon and leukocytes.
genes like me logo Genes that share expression patterns with RNF34: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for RNF34 Gene

Orthologs for RNF34 Gene

This gene was present in the common ancestor of animals.

Orthologs for RNF34 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia RNF34 34 35
  • 99.73 (n)
dog
(Canis familiaris)
Mammalia RNF34 34 35
  • 89.61 (n)
cow
(Bos Taurus)
Mammalia RNF34 34 35
  • 89.07 (n)
mouse
(Mus musculus)
Mammalia Rnf34 34 16 35
  • 86.83 (n)
rat
(Rattus norvegicus)
Mammalia Rnf34 34
  • 86.2 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia RNF34 35
  • 82 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia RNF34 35
  • 67 (a)
OneToOne
chicken
(Gallus gallus)
Aves RNF34 34 35
  • 75.51 (n)
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 80 (a)
OneToMany
-- 35
  • 62 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia rnf34 34
  • 67.62 (n)
zebrafish
(Danio rerio)
Actinopterygii rnf34a 34 35
  • 61.74 (n)
rnf34b 35
  • 57 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta CG17019 36 35
  • 50 (a)
Species where no ortholog for RNF34 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for RNF34 Gene

ENSEMBL:
Gene Tree for RNF34 (if available)
TreeFam:
Gene Tree for RNF34 (if available)

Paralogs for RNF34 Gene

Paralogs for RNF34 Gene

(1) SIMAP similar genes for RNF34 Gene using alignment to 6 proteins:

Pseudogenes.org Pseudogenes for RNF34 Gene

genes like me logo Genes that share paralogs with RNF34: view

Variants for RNF34 Gene

Sequence variations from dbSNP and Humsavar for RNF34 Gene

SNP ID Clin Chr 12 pos Sequence Context AA Info Type
rs10744761 -- 121,398,223(+) AAAAA(C/T)TAGCC upstream-variant-2KB
rs10744762 -- 121,401,898(+) TGTGC(A/C)AGATG intron-variant, downstream-variant-500B
rs10774594 -- 121,404,917(+) TTTGA(A/G)AATCC intron-variant
rs10849875 -- 121,398,176(+) AGACC(A/G)TCCTG upstream-variant-2KB
rs10849876 -- 121,398,302(+) aggag(A/G)cggag upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for RNF34 Gene

Variant ID Type Subtype PubMed ID
dgv522e212 CNV loss 25503493

Variation tolerance for RNF34 Gene

Residual Variation Intolerance Score: 16.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.31; 62.93% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for RNF34 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
RNF34

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for RNF34 Gene

Disorders for RNF34 Gene

Relevant External Links for RNF34

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
RNF34

No disorders were found for RNF34 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for RNF34 Gene

Publications for RNF34 Gene

  1. Isolation and characterization of a novel gene, hRFI, preferentially expressed in esophageal cancer. (PMID: 12118383) Sasaki S. … Croce C.M. (Oncogene 2002) 2 3 4 64
  2. The E3 ligase RNF34 is a novel negative regulator of the NOD1 pathway. (PMID: 25012219) Zhang R. … Liu F. (Cell. Physiol. Biochem. 2014) 3 4 64
  3. RNF34 is a cold-regulated E3 ubiquitin ligase for PGC-1I+ and modulates brown fat cell metabolism. (PMID: 22064484) Wei P. … Wang Y.X. (Mol. Cell. Biol. 2012) 3 4 64
  4. CARPs enhance p53 turnover by degrading 14-3-3sigma and stabilizing MDM2. (PMID: 18382127) Yang W. … El-Deiry W.S. (Cell Cycle 2008) 3 4 64
  5. CARPs are ubiquitin ligases that promote MDM2-independent p53 and phospho-p53ser20 degradation. (PMID: 17121812) Yang W. … El-Deiry W.S. (J. Biol. Chem. 2007) 3 4 64

Products for RNF34 Gene

Sources for RNF34 Gene

Content
Loading form....