Free for academic non-profit institutions. Other users need a Commercial license

Aliases for RELN Gene

Aliases for RELN Gene

  • Reelin 2 3 3 5
  • EC 3.4.21.- 4
  • EC 3.4.21 61
  • PRO1598 3
  • LIS2 3
  • ETL7 3
  • RL 3

External Ids for RELN Gene

Previous GeneCards Identifiers for RELN Gene

  • GC07M101596
  • GC07M101595
  • GC07M102658
  • GC07M102672
  • GC07M102706
  • GC07M102899
  • GC07M103112
  • GC07M097472

Summaries for RELN Gene

Entrez Gene Summary for RELN Gene

  • This gene encodes a large secreted extracellular matrix protein thought to control cell-cell interactions critical for cell positioning and neuronal migration during brain development. This protein may be involved in schizophrenia, autism, bipolar disorder, major depression and in migration defects associated with temporal lobe epilepsy. Mutations of this gene are associated with autosomal recessive lissencephaly with cerebellar hypoplasia. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described but their full length nature has not been determined. [provided by RefSeq, Jul 2008]

GeneCards Summary for RELN Gene

RELN (Reelin) is a Protein Coding gene. Diseases associated with RELN include Epilepsy, Familial Temporal Lobe, 7 and Lissencephaly 2. Among its related pathways are Lipoprotein metabolism and Focal Adhesion. GO annotations related to this gene include serine-type peptidase activity and very-low-density lipoprotein particle receptor binding.

UniProtKB/Swiss-Prot for RELN Gene

  • Extracellular matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it seems to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the extracellular domains of lipoprotein receptors VLDLR and LRP8/APOER2 induces tyrosine phosphorylation of DAB1 and modulation of TAU phosphorylation (By similarity).

Gene Wiki entry for RELN Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for RELN Gene

Genomics for RELN Gene

Regulatory Elements for RELN Gene

Enhancers for RELN Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH07G103988 1.6 FANTOM5 Ensembl ENCODE 11.9 0.0 -29 2.5 ATF1 PKNOX1 SIN3A ZNF48 YY1 GLIS2 ZNF766 KDM4B NCOA1 SMARCA4 RELN GC07P104114
GH07G103660 1.3 Ensembl ENCODE 9.5 +327.8 327809 3.1 PKNOX1 FOXA2 MLX ARNT ARID4B DMAP1 YY1 SLC30A9 ZNF766 FOS RELN RPL19P12 PIR34993 GC07P103650 GC07P103649 GC07P103686
GH07G103717 0.7 ENCODE 12.2 +270.7 270706 2.1 TBP ZNF362 TAF1 JUN CEBPB EP300 JUND GATA2 STAT3 TRIM24 RELN GC07P103723 GC07P103686
GH07G103636 0.9 Ensembl ENCODE 4.8 +351.8 351841 2.4 MIER1 REST EP300 GATA2 HMBOX1 FOS MAFK EZH2 NFE2L2 RELN GC07P103650 GC07P103649 PIR34993 LOC105375435
GH07G103704 0.9 FANTOM5 1.3 +284.8 284834 0.0 ATF1 ARNT NFRKB ZBTB40 YY1 ZNF766 ELK1 ETV6 RELB ZNF174 SLC26A5 RELN GC07P103723 GC07P103686
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around RELN on UCSC Golden Path with GeneCards custom track

Promoters for RELN Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000216225 -384 1001 ATF1 PKNOX1 SIN3A ZNF48 YY1 GLIS2 ZNF766 KDM4B NCOA1 SMARCA4

Genomic Location for RELN Gene

Chromosome:
7
Start:
103,471,784 bp from pter
End:
103,989,516 bp from pter
Size:
517,733 bases
Orientation:
Minus strand

Genomic View for RELN Gene

Genes around RELN on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RELN Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RELN Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for RELN Gene

Proteins for RELN Gene

  • Protein details for RELN Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P78509-RELN_HUMAN
    Recommended name:
    Reelin
    Protein Accession:
    P78509
    Secondary Accessions:
    • A4D0P9
    • A4D0Q0
    • Q86UJ0
    • Q86UJ8
    • Q8NDV0
    • Q9UDQ2

    Protein attributes for RELN Gene

    Size:
    3460 amino acids
    Molecular mass:
    388388 Da
    Quaternary structure:
    • Oligomer of disulfide-linked homodimers. Binds to the ectodomains of VLDLR and LRP8/APOER2 (By similarity).

    Alternative splice isoforms for RELN Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for RELN Gene

Selected DME Specific Peptides for RELN Gene

P78509:
  • PRYAETWDFHVS
  • WVDFVQFYIQIGGES
  • KAGKRQLVSWDLDT
  • IHILYLPE
  • LVMGCGQK
  • GNNLFFNE
  • YHEPRIISVELP
  • LSSRELIIQPGYMMQFKIVVGCEA
  • HMIQFSINLGCGT
  • GCKCDPGFSGPACE
  • PQHERSPADAGP
  • MTSVLFNSISLDFTNLVEVTQSLGFYLGN
  • QAQRVSYNVPLEARMKGVLLRWWQPRHNGTGHDQWALDHV
  • VNEDSFLQIDFAASCSVT
  • GCGQLAPYAHGDSLYFNGCQ
  • EFTQWRR
  • SCYAIELEYSVDLG
  • VPPFGLDGVYISEPCP
  • FLDSSQSRFLQFTLRLGSKSVLSTC
  • LPTQLKDNFNR
  • LKDDFEGQLESDRFLL
  • EEFESQP
  • GATWHLLLPLCY
  • DSWQLVQT
  • SCGDLHSVMLEYTKDAR
  • NATRFRLWQPYN
  • SRDLDCTNT
  • ALTNTTRLRWWQPF
  • SGGKPSRKCGI
  • LMEIFYDQ
  • TDSSSADPV
  • LKDDFNGNLHPDLWPEVYGAERGNLNG
  • TRFRWIQ
  • RITIQLPDHVSSSATQFRWIQKGEE
  • ASQTFPMFISESF
  • VIAQHQPKDF
  • RDCLPTNVEC
  • SGVCFCDLGYTA
  • LLDTFDFGP
  • PVRFRFYQKYSD
  • RYHLQRIL
  • SSMRYVETQSMQIGASYMIQF
  • EEIKPDLWMSLEGG
  • YIGPSCLKFCSGRGQCTR
  • LIFKGEGLRML
  • TKPLDLTRASKIMFVLQIGS
  • YSVNGGITW
  • DQRTVMLDTFSSAP
  • SSLCSTEHHPSSTYY
  • WALDNIL
  • ERFCDSPDGVM
  • WYRIQGGQVDIDCLSMDTAL
  • HFGKLHLCG
  • YPNAVRTAGFCGNPSFHLYWPNKKKDKTHN
  • CICDPGYSGP
  • DDIIILSEKQK
  • HDGLDQNDWAIDNVLISGS
  • SKPGFVNILLP
  • ARFVQFFMRLGCGKGVPDPRSQ
  • STRLRWWQPSENGHFYSPWVIDQILIGGNISG
  • APVLLQYSHDAG
  • EDVWAIDEI

Post-translational modifications for RELN Gene

  • Glycosylation at Asn140, Asn257, isoforms=2, 3289, Asn305, isoforms=2, 3628, isoforms=2, 31266, Asn1599, isoforms=2, 31749, isoforms=2, 31920, Asn2144, isoforms=2, 32268, Asn2316, Asn2568, isoforms=2, 32961, isoforms=2, 33015, Asn3072, isoforms=2, 33184, isoforms=2, 33411, and Asn3438
  • Modification sites at PhosphoSitePlus

Other Protein References for RELN Gene

Antibody Products

  • Abcam antibodies for RELN
  • Santa Cruz Biotechnology (SCBT) Antibodies for RELN

Domains & Families for RELN Gene

Suggested Antigen Peptide Sequences for RELN Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P78509

UniProtKB/Swiss-Prot:

RELN_HUMAN :
  • The basic C-terminal region is essential for secretion.
  • Belongs to the reelin family.
Domain:
  • The basic C-terminal region is essential for secretion.
Family:
  • Belongs to the reelin family.
genes like me logo Genes that share domains with RELN: view

No data available for Gene Families for RELN Gene

Function for RELN Gene

Molecular function for RELN Gene

GENATLAS Biochemistry:
mouse reelin homolog,338kDa,containing a CGG repeat in 5utr,expressed in pioneer neurons,fetal,postnatal brain and liver,involved in neuronal migration,mutated in mouse reeler
UniProtKB/Swiss-Prot Function:
Extracellular matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it seems to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the extracellular domains of lipoprotein receptors VLDLR and LRP8/APOER2 induces tyrosine phosphorylation of DAB1 and modulation of TAU phosphorylation (By similarity).

Enzyme Numbers (IUBMB) for RELN Gene

Gene Ontology (GO) - Molecular Function for RELN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004712 protein serine/threonine/tyrosine kinase activity ISS --
GO:0008233 peptidase activity IEA --
GO:0008236 serine-type peptidase activity IEA --
GO:0016787 hydrolase activity IEA --
GO:0046872 metal ion binding IEA --
genes like me logo Genes that share ontologies with RELN: view
genes like me logo Genes that share phenotypes with RELN: view

Human Phenotype Ontology for RELN Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Model Products

miRNA for RELN Gene

miRTarBase miRNAs that target RELN

No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for RELN Gene

Localization for RELN Gene

Subcellular locations from UniProtKB/Swiss-Prot for RELN Gene

Secreted, extracellular space, extracellular matrix.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RELN gene
Compartment Confidence
plasma membrane 5
extracellular 5
cytoskeleton 2
nucleus 2
mitochondrion 1
endoplasmic reticulum 1
cytosol 1
lysosome 1

Gene Ontology (GO) - Cellular Components for RELN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region TAS --
GO:0005578 proteinaceous extracellular matrix IEA --
GO:0005615 extracellular space ISS --
GO:0005737 cytoplasm ISS --
GO:0005886 plasma membrane IEA --
genes like me logo Genes that share ontologies with RELN: view

Pathways & Interactions for RELN Gene

genes like me logo Genes that share pathways with RELN: view

SIGNOR curated interactions for RELN Gene

Activates:

Gene Ontology (GO) - Biological Process for RELN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000904 cell morphogenesis involved in differentiation ISS --
GO:0001764 neuron migration ISS --
GO:0006508 proteolysis IEA --
GO:0007155 cell adhesion IEA --
GO:0007275 multicellular organism development IEA --
genes like me logo Genes that share ontologies with RELN: view

Drugs & Compounds for RELN Gene

(9) Drugs for RELN Gene - From: Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials

(8) Additional Compounds for RELN Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with RELN: view

Transcripts for RELN Gene

Unigene Clusters for RELN Gene

Reelin:
Representative Sequences:

Alternative Splicing Database (ASD) splice patterns (SP) for RELN Gene

No ASD Table

Relevant External Links for RELN Gene

GeneLoc Exon Structure for
RELN
ECgene alternative splicing isoforms for
RELN

Expression for RELN Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for RELN Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for RELN Gene

This gene is overexpressed in Brain - Cerebellar Hemisphere (x19.2) and Brain - Cerebellum (x12.0).

Protein differential expression in normal tissues from HIPED for RELN Gene

This gene is overexpressed in Vitreous humor (45.5) and Cerebrospinal fluid (17.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for RELN Gene



NURSA nuclear receptor signaling pathways regulating expression of RELN Gene:

RELN

SOURCE GeneReport for Unigene cluster for RELN Gene:

Hs.655654

mRNA Expression by UniProt/SwissProt for RELN Gene:

P78509-RELN_HUMAN
Tissue specificity: Abundantly produced during brain ontogenesis by the Cajal-Retzius cells and other pioneer neurons located in the telencephalic marginal zone and by granule cells of the external granular layer of the cerebellum. In adult brain, preferentially expressed in GABAergic interneurons of prefrontal cortices, temporal cortex, hippocampus and glutamatergic granule cells of cerebellum. Expression is reduced to about 50% in patients with schizophrenia. Also expressed in fetal and adult liver.

Evidence on tissue expression from TISSUES for RELN Gene

  • Nervous system(4.6)
  • Liver(4.3)

Phenotype-based relationships between genes and organs from Gene ORGANizer for RELN Gene

Germ Layers:
  • ectoderm
  • mesoderm
Systems:
  • nervous
  • skeletal muscle
  • skeleton
Organs:
Head and neck:
  • brain
  • cranial nerve
  • ear
  • face
  • forehead
  • head
  • nose
  • skull
General:
  • peripheral nervous system
genes like me logo Genes that share expression patterns with RELN: view

Primer Products

No data available for Protein tissue co-expression partners for RELN Gene

Orthologs for RELN Gene

This gene was present in the common ancestor of chordates.

Orthologs for RELN Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia RELN 34 35
  • 99.52 (n)
cow
(Bos Taurus)
Mammalia RELN 34 35
  • 92.5 (n)
oppossum
(Monodelphis domestica)
Mammalia RELN 35
  • 92 (a)
OneToOne
dog
(Canis familiaris)
Mammalia RELN 34 35
  • 91.87 (n)
mouse
(Mus musculus)
Mammalia Reln 34 16 35
  • 88.37 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia RELN 35
  • 88 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Reln 34
  • 87.72 (n)
chicken
(Gallus gallus)
Aves RELN 34 35
  • 81.37 (n)
lizard
(Anolis carolinensis)
Reptilia RELN 35
  • 89 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia reln 34
  • 76.46 (n)
African clawed frog
(Xenopus laevis)
Amphibia reln 34
zebrafish
(Danio rerio)
Actinopterygii relnl 35
  • 75 (a)
OneToMany
CABZ01102516.1 35
  • 66 (a)
OneToMany
CABZ01102518.1 35
  • 66 (a)
OneToMany
reln 34
  • 65.45 (n)
RELN (1 of 4) 35
  • 56 (a)
OneToMany
-- 34
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 40 (a)
OneToMany
-- 35
  • 37 (a)
OneToMany
Species where no ortholog for RELN was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for RELN Gene

ENSEMBL:
Gene Tree for RELN (if available)
TreeFam:
Gene Tree for RELN (if available)

Paralogs for RELN Gene

No data available for Paralogs for RELN Gene

Variants for RELN Gene

Polymorphic Variants from UniProtKB/Swiss-Prot for RELN Gene

RELN_HUMAN-P78509
A polymorphic GGC triplet repeat located in the 5-UTR region of RELN gene, which harbors in the normal population 8 to 10 repeats, is significantly increased in autistic patients to carry 4 to 23 additional repeats.

Sequence variations from dbSNP and Humsavar for RELN Gene

SNP ID Clin Chr 07 pos Sequence Context AA Info Type
rs201044262 Pathogenic, Epilepsy, familial temporal lobe, 7 (ETL7) [MIM:616436] 103,640,597(+) ATGAC(A/G)GGCCA reference, missense
rs768119894 Pathogenic, Epilepsy, familial temporal lobe, 7 (ETL7) [MIM:616436] 103,636,370(+) TATGG(C/T)AAGAG reference, missense
rs794727996 Pathogenic, Epilepsy, familial temporal lobe, 7 (ETL7) [MIM:616436] 103,635,498(-) TGTTG(A/C)ATTAT reference, missense
rs794727997 Pathogenic, Epilepsy, familial temporal lobe, 7 (ETL7) [MIM:616436] 103,503,158(-) ACTTC(A/G/T)GTGTG intron-variant, reference, missense
rs794727998 Pathogenic, Epilepsy, familial temporal lobe, 7 (ETL7) [MIM:616436] 103,636,250(-) CCTTG(A/G)CAGCT reference, missense

Structural Variations from Database of Genomic Variants (DGV) for RELN Gene

Variant ID Type Subtype PubMed ID
dgv1945e212 CNV loss 25503493
dgv3633n106 CNV deletion 24896259
dgv424n21 CNV loss 19592680
esv1599327 CNV deletion 17803354
esv2236652 CNV deletion 18987734
esv2556237 CNV deletion 19546169
esv2659743 CNV deletion 23128226
esv2734954 CNV deletion 23290073
esv3387047 CNV insertion 20981092
esv3542198 CNV deletion 23714750
esv3542202 CNV deletion 23714750
esv3572039 CNV loss 25503493
esv3576411 CNV gain 25503493
esv3614380 CNV loss 21293372
esv3614381 CNV gain 21293372
esv3614382 CNV loss 21293372
esv3614383 CNV gain 21293372
esv3614384 CNV gain 21293372
esv3716 CNV loss 18987735
esv3891172 CNV gain 25118596
esv7153 CNV loss 19470904
esv990549 CNV deletion 20482838
nsv1030128 CNV gain 25217958
nsv1074540 CNV deletion 25765185
nsv1150895 CNV deletion 26484159
nsv516122 CNV gain 19592680
nsv517254 CNV loss 19592680
nsv523031 CNV gain 19592680
nsv523466 CNV loss 19592680
nsv523887 CNV loss 19592680
nsv524101 CNV loss 19592680
nsv5886 CNV insertion 18451855
nsv818543 CNV gain 17921354
nsv831085 CNV gain 17160897
nsv957589 CNV deletion 24416366

Variation tolerance for RELN Gene

Residual Variation Intolerance Score: 4.33% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 9.55; 88.90% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for RELN Gene

Human Gene Mutation Database (HGMD)
RELN
SNPedia medical, phenotypic, and genealogical associations of SNPs for
RELN

Disorders for RELN Gene

MalaCards: The human disease database

(22) MalaCards diseases for RELN Gene - From: OMIM, ClinVar, GeneTests, Orphanet, Swiss-Prot, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
epilepsy, familial temporal lobe, 7
  • familial temporal lobe epilepsy 7
lissencephaly 2
  • norman-roberts syndrome
autosomal dominant epilepsy with auditory features
  • adeaf
temporal lobe epilepsy
  • epilepsy, temporal lobe
bipolar disorder
  • bipolar depression
- elite association - COSMIC cancer census association via MalaCards
Search RELN in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

RELN_HUMAN
  • Epilepsy, familial temporal lobe, 7 (ETL7) [MIM:616436]: A focal form of epilepsy characterized by recurrent seizures that arise from foci within the temporal lobe. Seizures are usually accompanied by sensory symptoms, most often auditory in nature. {ECO:0000269 PubMed:26046367}. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Lissencephaly 2 (LIS2) [MIM:257320]: A classic type lissencephaly associated with ataxia, mental retardation, seizures and abnormalities of the cerebellum, hippocampus and brainstem. {ECO:0000269 PubMed:10973257}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Relevant External Links for RELN

Genetic Association Database (GAD)
RELN
Human Genome Epidemiology (HuGE) Navigator
RELN
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
RELN
genes like me logo Genes that share disorders with RELN: view

No data available for Genatlas for RELN Gene

Publications for RELN Gene

  1. The human reelin gene: isolation, sequencing, and mapping on chromosome 7. (PMID: 9049633) DeSilva U. … Green E.D. (Genome Res. 1997) 2 3 4 22 64
  2. Replication of association between working memory and Reelin, a potential modifier gene in schizophrenia. (PMID: 19922905) Wedenoja J. … Peltonen L. (Biol. Psychiatry 2010) 3 22 46 64
  3. A genome-wide analysis identifies genetic variants in the RELN gene associated with otosclerosis. (PMID: 19230858) Schrauwen I. … Van Camp G. (Am. J. Hum. Genet. 2009) 3 22 46 64
  4. The association analysis of RELN and GRM8 genes with autistic spectrum disorder in Chinese Han population. (PMID: 17955477) Li H. … Zhao Z. (Am. J. Med. Genet. B Neuropsychiatr. Genet. 2008) 3 22 46 64
  5. Genetic analysis of reelin gene (RELN) SNPs: no association with autism spectrum disorder in the Indian population. (PMID: 18597938) Dutta S. … Usha R. (Neurosci. Lett. 2008) 3 22 46 64

Products for RELN Gene

Sources for RELN Gene

Content
Loading form....