Free for academic non-profit institutions. Other users need a Commercial license

Aliases for RAF1 Gene

Aliases for RAF1 Gene

  • Raf-1 Proto-Oncogene, Serine/Threonine Kinase 2 3 5
  • V-Raf-1 Murine Leukemia Viral Oncogene Homolog 1 2 3
  • C-Raf Proto-Oncogene, Serine/Threonine Kinase 2 3
  • Proto-Oncogene C-RAF 3 4
  • EC 2.7.11.1 4 56
  • Raf-1 3 4
  • CRAF 3 4
  • V-Raf-1 Murine Leukemia Viral Oncogene-Like Protein 1 3
  • RAF Proto-Oncogene Serine/Threonine-Protein Kinase 3
  • Raf Proto-Oncogene Serine/Threonine Protein Kinase 3
  • Oncogene RAF1 3
  • EC 2.7.11 56
  • CMD1NN 3
  • C-Raf 3
  • NS5 3
  • RAF 4

External Ids for RAF1 Gene

Previous GeneCards Identifiers for RAF1 Gene

  • GC03M012554
  • GC03M012600
  • GC03M012559
  • GC03M012625

Summaries for RAF1 Gene

Entrez Gene Summary for RAF1 Gene

  • This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2. [provided by RefSeq, Jul 2008]

CIViC summary for RAF1 Gene

GeneCards Summary for RAF1 Gene

RAF1 (Raf-1 Proto-Oncogene, Serine/Threonine Kinase) is a Protein Coding gene. Diseases associated with RAF1 include Noonan Syndrome 5 and Leopard Syndrome 2. Among its related pathways are G-protein signaling N-RAS regulation pathway and RET signaling. Gene Ontology (GO) annotations related to this gene include identical protein binding and protein kinase activity. An important paralog of this gene is ARAF.

UniProtKB/Swiss-Prot for RAF1 Gene

  • Serine/threonine-protein kinase that acts as a regulatory link between the membrane-associated Ras GTPases and the MAPK/ERK cascade, and this critical regulatory link functions as a switch determining cell fate decisions including proliferation, differentiation, apoptosis, survival and oncogenic transformation. RAF1 activation initiates a mitogen-activated protein kinase (MAPK) cascade that comprises a sequential phosphorylation of the dual-specific MAPK kinases (MAP2K1/MEK1 and MAP2K2/MEK2) and the extracellular signal-regulated kinases (MAPK3/ERK1 and MAPK1/ERK2). The phosphorylated form of RAF1 (on residues Ser-338 and Ser-339, by PAK1) phosphorylates BAD/Bcl2-antagonist of cell death at Ser-75. Phosphorylates adenylyl cyclases: ADCY2, ADCY5 and ADCY6, resulting in their activation. Phosphorylates PPP1R12A resulting in inhibition of the phosphatase activity. Phosphorylates TNNT2/cardiac muscle troponin T. Can promote NF-kB activation and inhibit signal transducers involved in motility (ROCK2), apoptosis (MAP3K5/ASK1 and STK3/MST2), proliferation and angiogenesis (RB1). Can protect cells from apoptosis also by translocating to the mitochondria where it binds BCL2 and displaces BAD/Bcl2-antagonist of cell death. Regulates Rho signaling and migration, and is required for normal wound healing. Plays a role in the oncogenic transformation of epithelial cells via repression of the TJ protein, occludin (OCLN) by inducing the up-regulation of a transcriptional repressor SNAI2/SLUG, which induces down-regulation of OCLN. Restricts caspase activation in response to selected stimuli, notably Fas stimulation, pathogen-mediated macrophage apoptosis, and erythroid differentiation.

Tocris Summary for RAF1 Gene

  • Raf kinases, a family of three serine/threonine kinases, are part of the Ras-MAPK signaling cascade and phosphorylate MEK. Upon growth factor stimulation, Raf-1 (c-Raf) is activated by GTP-bound Ras and recruited to the cell membrane. This activation process is tightly regulated.

Gene Wiki entry for RAF1 Gene

Additional gene information for RAF1 Gene

No data available for PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for RAF1 Gene

Genomics for RAF1 Gene

GeneHancer (GH) Regulatory Elements for RAF1 Gene

Promoters and enhancers for RAF1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH03I012661 Promoter/Enhancer 2.3 EPDnew Ensembl ENCODE dbSUPER 555.5 +0.8 777 3.5 PKNOX1 SMAD1 ARNT ARID4B SIN3A DMAP1 YY1 SLC30A9 POLR2B ZNF766 RAF1 TAMM41 MKRN2OS MKRN2 TSEN2 GC03M012623
GH03I012646 Enhancer 1.7 FANTOM5 Ensembl ENCODE dbSUPER 30.1 +16.1 16125 3.4 HDGF PKNOX1 FOXA2 SMAD1 MLX ARID4B DMAP1 IRF4 ETS1 YY1 MKRN2 RAF1 MKRN2OS CRIP1P1 TAMM41 TSEN2 GC03M012623
GH03I012680 Enhancer 1.4 FANTOM5 Ensembl ENCODE dbSUPER 21.6 -17.7 -17691 2.2 PYGO2 ZNF384 ZIC2 YY1 ZNF335 POLR2A NFYB PRDM10 MAFK NFYA RAF1 MKRN2OS CAND2 CRIP1P1 TMEM40
GH03I012998 Enhancer 1.7 FANTOM5 Ensembl ENCODE dbSUPER 12.8 -335.6 -335560 2.4 HDGF PKNOX1 FOXA2 ARNT ARID4B DMAP1 IRF4 POLR2B ZNF766 SP5 RAF1 IQSEC1 TSEN2 GC03P013026 PIR41577 GC03M014446
GH03I012675 Enhancer 1.2 Ensembl ENCODE dbSUPER 6.4 -12.3 -12287 2 ELF3 FOXA2 ARID4B ZNF48 RARA ZNF207 THAP11 MIXL1 ELK4 SP5 MKRN2 RAF1 MKRN2OS TSEN2 CRIP1P1 TMEM40
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around RAF1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the RAF1 gene promoter:

Genomic Locations for RAF1 Gene

Genomic Locations for RAF1 Gene
chr3:12,583,601-12,664,226
(GRCh38/hg38)
Size:
80,626 bases
Orientation:
Minus strand
chr3:12,625,100-12,705,725
(GRCh37/hg19)

Genomic View for RAF1 Gene

Genes around RAF1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
RAF1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for RAF1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for RAF1 Gene

Proteins for RAF1 Gene

  • Protein details for RAF1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P04049-RAF1_HUMAN
    Recommended name:
    RAF proto-oncogene serine/threonine-protein kinase
    Protein Accession:
    P04049
    Secondary Accessions:
    • B0LPH8
    • B2R5N3
    • Q15278
    • Q9UC20

    Protein attributes for RAF1 Gene

    Size:
    648 amino acids
    Molecular mass:
    73052 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Monomer. Homodimer. Heterodimerizes with BRAF and this heterodimer possesses a highly increased kinase activity compared to the respective homodimers or monomers (PubMed:16508002). Heterodimerization is mitogen-regulated and enhanced by 14-3-3 proteins (PubMed:16508002). MAPK1/ERK2 activation can induce a negative feedback that promotes the dissociation of the heterodimer (PubMed:16508002). Forms a multiprotein complex with Ras (M-Ras/MRAS), SHOC2 and protein phosphatase 1 (PPP1CA, PPP1CB and PPP1CC) (PubMed:16630891). Interacts with Ras proteins; the interaction is antagonized by RIN1 (PubMed:11784866). Weakly interacts with RIT1. Interacts (via N-terminus) with RGS14 (via RBD domains); the interaction mediates the formation of a ternary complex with BRAF, a ternary complex inhibited by GNAI1 (By similarity). Interacts with STK3/MST2; the interaction inhibits its pro-apoptotic activity (PubMed:15618521). Interacts (when phosphorylated at Ser-259) with YWHAZ (unphosphorylated at Thr-232) (PubMed:9360956). Interacts with MAP2K1/MEK1 and MAP2K2/MEK2 (By similarity). Interacts with MAP3K5/ASF1 (via N-terminus) and this interaction inhibits the proapoptotic function of MAP3K5/ASK1 (PubMed:11427728). Interacts with PAK1 (via kinase domain) (PubMed:11733498). The phosphorylated form interacts with PIN1 (By similarity). The Ser-338 and Ser-339 phosphorylated form (by PAK1) interacts with BCL2 (PubMed:15849194). Interacts with PEBP1/RKIP and this interaction is enhanced if RAF1 is phosphorylated on residues Ser-338, Ser-339, Tyr-340 and Tyr-341 (PubMed:18294816). Interacts with ADCY2, ADCY5, ADCY6, DGKH, RCAN1/DSCR1, PPP1R12A, PKB/AKT1, PPP2CA, PPP2R1B, SPRY2, SPRY4, CNKSR1/CNK1, KSR2 and PHB/prohibitin (PubMed:10801873, PubMed:11719507, PubMed:12717443, PubMed:15385642, PubMed:15935327, PubMed:19710016, PubMed:10576742). Interacts with ROCK2 (By similarity). In its active form, interacts with PRMT5 (PubMed:21917714). Interacts with FAM83B; displaces 14-3-3 proteins from RAF1 and activates RAF1 (PubMed:22886302). Interacts with PDE8A; the interaction promotes RAF1 activity (PubMed:23509299).

    Three dimensional structures from OCA and Proteopedia for RAF1 Gene

    Alternative splice isoforms for RAF1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for RAF1 Gene

Selected DME Specific Peptides for RAF1 Gene

P04049:
  • LYKNCPKA
  • GIVLYELM
  • GSVLWMA
  • NILLFMG
  • SPNNLSPTGWS
  • RLDWNTDA
  • SNGFGFK
  • EPSLHRAAHTEDI
  • WMAPEVI
  • CISPTIVQQFGYQRRASDDGK
  • RKTFLKLAFCDICQKFLLN
  • LWMAPEVIRMQD
  • TQEKNKIRPRGQRDSSYYWEIEASEV
  • TVKIGDFGLATVK
  • HSESASPSA
  • ARQTAQGMDYLHAK
  • LKVRGLQPECCAVFRL
  • ERPLFPQIL
  • LPNKQRTVV
  • RWSGSQQVEQ
  • FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPN
  • VPLTTHNF
  • SSPSSEGSLSQRQRSTSTPNVHMVS
  • ASEVMLS
  • TQWCEGSSLY
  • HINNRDQIIFMVGRGYASPDLS
  • GMSLHDCLMK
  • LPSLTMRR
  • WHGDVAVK
  • RSASEPSL
  • GFRCQTCGYKFH
  • KSNNIFLH

Post-translational modifications for RAF1 Gene

  • Methylated at Arg-563 in response to EGF treatment. This modification leads to destabilization of the protein, possibly through proteasomal degradation.
  • Phosphorylation at Thr-269, Ser-338, Tyr-341, Thr-491 and Ser-494 results in its activation. Phosphorylation at Ser-29, Ser-43, Ser-289, Ser-296, Ser-301 and Ser-642 by MAPK1/ERK2 results in its inactivation. Phosphorylation at Ser-259 induces the interaction with YWHAZ and inactivates kinase activity. Dephosphorylation of Ser-259 by the complex containing protein phosphatase 1, SHOC2 and M-Ras/MRAS relieves inactivation, leading to stimulate RAF1 activity. Phosphorylation at Ser-338 by PAK1 and PAK5 and Ser-339 by PAK1 is required for its mitochondrial localization. Phosphorylation at Ser-621 in response to growth factor treatment stabilizes the protein, possibly by preventing proteasomal degradation. Phosphorylation at Ser-289, Ser-296, Ser-301, Ser-338 and Ser-621 are somehow linked to the methylation potential of cells. Treatment of cells with HGF in the presence of the methylation inhibitor 5-methylthioadenosine (MTA) results in increased phosphorylation at Ser-338 and Ser-621 and decreased phosphorylation at Ser-296, Ser-301 and Ser-338. Dephosphorylation at Ser-338 by PPP5C results in a activity decrease.

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for RAF1 (RAF1)
  • Abcam antibodies for RAF1

Domains & Families for RAF1 Gene

Gene Families for RAF1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Cancer-related genes
  • Disease related genes
  • Enzymes
  • FDA approved drug targets
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

P04049

UniProtKB/Swiss-Prot:

RAF1_HUMAN :
  • Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
Family:
  • Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. RAF subfamily.
genes like me logo Genes that share domains with RAF1: view

Function for RAF1 Gene

Molecular function for RAF1 Gene

GENATLAS Biochemistry:
murine sarcoma viral (v-raf-1) oncogene homolog 1 (mitogenic factor) interacting with TC21 for activation and translocation to plasma membrane
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Regulation is a highly complex process involving membrane recruitment, protein-protein interactions, dimerization, and phosphorylation/dephosphorylation events. Ras-GTP recruits RAF1 to the membrane, thereby promoting its activation. The inactive conformation of RAF1 is maintained by autoinhibitory interactions occurring between the N-terminal regulatory and the C-terminal catalytic domains and by the binding of a 14-3-3 protein that contacts two phosphorylation sites, Ser-259 and Ser-621. Upon mitogenic stimulation, Ras and PPP2R1A cooperate to release autoinhibition and the subsequent phosphorylation of activating sites: Ser-338, Tyr-341, Thr-491, and Ser-494, yields a fully active kinase. Through a negative feedback mechanism involving MAPK1/ERK2, RAF1 is phosphorylated on Ser-29, Ser-43, Ser-289, Ser-296, Ser-301 and Ser-642 by MAPK1/ERK2, which yields an inactive, desensitized kinase. The signaling-competent conformation of RAF1 is finally re-established by the coordinated action of PIN1, a prolyl isomerase that converts pSer and pThr residues from the cis to the trans conformation, which is preferentially recognized and dephosphorylated by PPP2R1A. Activated by homodimerization and heterodimerization (with BRAF). Also regulated through association with other proteins such as KSR2, CNKSR1/CNK1, PEBP1/RKIP, PHB/prohibitin and SPRY4. PEBP1/RKIP acts by dissociating RAF1 from its substrates MAP2K1/MEK1 and MAP2K2/MEK2. PHB/prohibitin facilitates the displacement of 14-3-3 from RAF1 by activated Ras, thereby promoting cell membrane localization and phosphorylation of RAF1 at the activating Ser-338. SPRY4 inhibits Ras-independent, but not Ras-dependent, activation of RAF1. CNKSR1/CNK1 regulates Src-mediated RAF1 activation.
UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase that acts as a regulatory link between the membrane-associated Ras GTPases and the MAPK/ERK cascade, and this critical regulatory link functions as a switch determining cell fate decisions including proliferation, differentiation, apoptosis, survival and oncogenic transformation. RAF1 activation initiates a mitogen-activated protein kinase (MAPK) cascade that comprises a sequential phosphorylation of the dual-specific MAPK kinases (MAP2K1/MEK1 and MAP2K2/MEK2) and the extracellular signal-regulated kinases (MAPK3/ERK1 and MAPK1/ERK2). The phosphorylated form of RAF1 (on residues Ser-338 and Ser-339, by PAK1) phosphorylates BAD/Bcl2-antagonist of cell death at Ser-75. Phosphorylates adenylyl cyclases: ADCY2, ADCY5 and ADCY6, resulting in their activation. Phosphorylates PPP1R12A resulting in inhibition of the phosphatase activity. Phosphorylates TNNT2/cardiac muscle troponin T. Can promote NF-kB activation and inhibit signal transducers involved in motility (ROCK2), apoptosis (MAP3K5/ASK1 and STK3/MST2), proliferation and angiogenesis (RB1). Can protect cells from apoptosis also by translocating to the mitochondria where it binds BCL2 and displaces BAD/Bcl2-antagonist of cell death. Regulates Rho signaling and migration, and is required for normal wound healing. Plays a role in the oncogenic transformation of epithelial cells via repression of the TJ protein, occludin (OCLN) by inducing the up-regulation of a transcriptional repressor SNAI2/SLUG, which induces down-regulation of OCLN. Restricts caspase activation in response to selected stimuli, notably Fas stimulation, pathogen-mediated macrophage apoptosis, and erythroid differentiation.

Enzyme Numbers (IUBMB) for RAF1 Gene

Phenotypes From GWAS Catalog for RAF1 Gene

Gene Ontology (GO) - Molecular Function for RAF1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004672 protein kinase activity IEA,TAS 8063729
GO:0004674 protein serine/threonine kinase activity IEA,IDA 19667065
GO:0004709 MAP kinase kinase kinase activity IBA --
GO:0005057 signal transducer activity, downstream of receptor IEA --
genes like me logo Genes that share ontologies with RAF1: view

Phenotypes for RAF1 Gene

MGI mutant phenotypes for RAF1:
inferred from 12 alleles
GenomeRNAi human phenotypes for RAF1:
genes like me logo Genes that share phenotypes with RAF1: view

Human Phenotype Ontology for RAF1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for RAF1 Gene

MGI Knock Outs for RAF1:

Animal Model Products

Clone Products

  • Addgene plasmids for RAF1

No data available for Transcription Factor Targets and HOMER Transcription for RAF1 Gene

Localization for RAF1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for RAF1 Gene

Cytoplasm. Cell membrane. Mitochondrion. Nucleus. Note=Colocalizes with RGS14 and BRAF in both the cytoplasm and membranes. Phosphorylation at Ser-259 impairs its membrane accumulation. Recruited to the cell membrane by the active Ras protein. Phosphorylation at Ser-338 and Ser-339 by PAK1 is required for its mitochondrial localization. Retinoic acid-induced Ser-621 phosphorylated form of RAF1 is predominantly localized at the nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for RAF1 gene
Compartment Confidence
plasma membrane 5
mitochondrion 5
nucleus 5
cytosol 5
golgi apparatus 4
extracellular 2
cytoskeleton 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nuclear speckles (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for RAF1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IEA --
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IDA,ISS --
GO:0005739 mitochondrion IEA --
GO:0005741 mitochondrial outer membrane TAS 8929532
genes like me logo Genes that share ontologies with RAF1: view

Pathways & Interactions for RAF1 Gene

SuperPathway Contained pathways
1 RET signaling
2 IL-2 Pathway
3 Endometrial cancer
.52
.47
4 Regulation of lipid metabolism Insulin signaling-generic cascades
5 Common Cytokine Receptor Gamma-Chain Family Signaling Pathways
genes like me logo Genes that share pathways with RAF1: view

Pathways by source for RAF1 Gene

SIGNOR curated interactions for RAF1 Gene

Gene Ontology (GO) - Biological Process for RAF1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade TAS --
GO:0000186 activation of MAPKK activity IDA 10644344
GO:0001666 response to hypoxia IEA --
GO:0001678 cellular glucose homeostasis IEA --
GO:0001934 positive regulation of protein phosphorylation IEA --
genes like me logo Genes that share ontologies with RAF1: view

Drugs & Compounds for RAF1 Gene

(116) Drugs for RAF1 Gene - From: DrugBank, PharmGKB, ApexBio, DGIdb, FDA Approved Drugs, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Sorafenib Approved, Investigational Pharma Target, inhibitor, inhibitors Raf kinases and tyrosine kinases inhibitor, RAF, VEGFR2, and PDGFR-beta inhibitors, Kinase Inhibitors, Vascular endothelial growth factor (VEGF) and VEGF receptor (VEGFR) inhibitors 717
regorafenib Approved Pharma Target, inhibitor Inhibitor of VEGFR/PDGFR/FGFR/mutant kit/RET/Raf-1, Kinase Inhibitors, Vascular endothelial growth factor (VEGF) and VEGF receptor (VEGFR) inhibitors 0
Cisplatin Approved Pharma Inhibits DNA synthesis,chemotherapy drug, Potent pro-apoptotic anticancer agent; activates caspase-3, Platinum 2906
Docetaxel Approved May 1996, Investigational Pharma Microtubulin disassembly inhibitor, Tubulin and VEGF inhibitor, Taxanes 2040
Paclitaxel Approved, Vet_approved Pharma Tubulin and Bcl2 inhibitor, Taxanes 3027

(53) Additional Compounds for RAF1 Gene - From: Novoseek, Tocris, and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ZM 336372
208260-29-1
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
Diglycerides Group A
  • 1-Myristoyl-2-pentadecanoyl-sn-glycerol
  • DAG(14:0/15:0)
  • DAG(29:0)
  • DG(14:0/15:0)
  • DG(29:0)
Diglycerides Group B
  • 1-Palmitoleoyl-2-arachidonoyl-sn-glycerol
  • DAG(16:1/20:4)
  • DAG(16:1n7/20:4n6)
  • DAG(16:1w7/20:4w6)
  • DAG(36:5)
Diglycerides Group C
  • 1-Pentadecanoyl-3-behenoyl-sn-glycerol
  • 1-Pentadecanoyl-3-docosanoyl-sn-glycerol
  • DAG(15:0/0:0/22:0)
  • DAG(37:0)
  • DG(37:0)

(4) Tocris Compounds for RAF1 Gene

Compound Action Cas Number
GW 5074 Potent, selective c-Raf1 kinase inhibitor 220904-83-6
KG 5 PDGFRbeta, B-Raf, c-Raf, FLT3 and KIT inhibitor 877874-85-6
Kobe 0065 H-Ras-cRaf1 interaction inhibitor; inhibits Raf signaling 436133-68-5
ZM 336372 Potent, selective c-Raf inhibitor 208260-29-1

(23) ApexBio Compounds for RAF1 Gene

Compound Action Cas Number
AZ 628 Raf kinases,potent and ATP-competitive 878739-06-1
B-Raf IN 1 950736-05-7
B-Raf inhibitor 1 1093100-40-3
CEP-32496 BRAF(V600E)inhibitor,highly potent 1188910-76-0
CEP-32496 hydrochloride B-Raf/C-Raf inhibitor,highly potent 1227678-26-3