Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

PTGES3 Gene

protein-coding   GIFtS: 57
GCID: GC12M057057

prostaglandin E synthase 3 (cytosolic)
 Explore 24 diseases affiliated with
PTGES3 via
MalaCards
our new
 Human Malady Compendium 
Biological research products
for PTGES3    

Aliases
for PTGES3 gene

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section
Aliases
Prostaglandin E Synthase 3 (Cytosolic)1 2     Hsp90 Co-Chaperone2 3
TEBP1 2 3     EC 5.3.99.33 8
CPGES1     P232 3 5
P232 3 5     Cytosolic Prostaglandin E Synthase2
Cytosolic Prostaglandin E2 Synthase2 3     Prostaglandin E Synthase 32
Progesterone Receptor Complex P232 3     Unactive Progesterone Receptor, 23 KD2
Telomerase-Binding Protein P232 3     

External Ids:    HGNC: 160491   Entrez Gene: 107282   Ensembl: ENSG000001109587   OMIM: 6070615   UniProtKB: Q151853   

Export aliases for PTGES3 gene to outside databases

Previous GC identifers: GC12M055344 GC12M054096


Summaries
for PTGES3 gene

(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section
UniProtKB/Swiss-Prot: TEBP_HUMAN, Q15185
Function: Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts
receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes

Gene Wiki entry for PTGES3


Genomic Views
for PTGES3 gene

(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000012.11  NC_018923.1  NT_029419.12  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the PTGES3 gene promoter:
         MAZR   MIF-1   NF-kappaB   Arnt   C/EBPalpha   CHOP-10   HOXA5   COMP1   ARP-1   NF-kappaB1   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmid: PTGES3 promoter sequence
   Search SABiosciences Chromatin IP Primers for PTGES3

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat PTGES3


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 12q13.3|12   Ensembl cytogenetic band:  12q13.3   HGNC cytogenetic band: 12q13.13

PTGES3 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
PTGES3 gene location

GeneLoc information about chromosome 12         GeneLoc Exon Structure

GeneLoc location for GC12M057057:  view genomic region     (about GC identifiers)

Start:
 57,057,125 bp from pter      End:
 57,082,159 bp from pter
Size:
 25,035 bases      Orientation:
 minus strand

Proteins
for PTGES3 gene

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section
UniProtKB/Swiss-Prot: TEBP_HUMAN, Q15185 (See protein sequence)
Recommended Name: Prostaglandin E synthase 3  
Size: 160 amino acids; 18697 Da
Subunit: Binds to the progesterone receptor. Interacts with TERT; the interaction, together with HSP90AA1, is required
for correct assembly and stabilization of the telomerase holoenzyme complex
Subcellular location: Cytoplasm
2 PDB 3D structures from and Proteopedia for PTGES3:
1EJF (3D)        1LG0 (3D)    
Secondary accessions: A8K7D0 Q8WU70

Explore the universe of human proteins at neXtProt for PTGES3: NX_Q15185

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_Q15185

    • 3 DME Specific Peptides for PTGES3 (Q15185)
     DVDLPEVDGADDDS  SKHKRTDRSILCCLRKGESGQ  WPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFS 

    PTGES3 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins: NP_006592.3  
    ENSEMBL proteins: 
     ENSP00000262033   ENSP00000405299   ENSP00000402385   ENSP00000414892   ENSP00000389090  
    Reactome Protein details: Q15185
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Enzo Life Sciences proteins for PTGES3
    OriGene Purified Protein: PTGES3
    OriGene Protein Over-expression Lysate: PTGES3
    OriGene Custom Protein Services for PTGES3 
    GenScript Custom Purified and Recombinant Proteins Services for PTGES3
    Novus Biologicals PTGES3 Proteins
    Novus Biologicals PTGES3 Lysate
    Browse Sino Biological Recombinant Proteins
    ProSpec Recombinant Protein for PTGES3
    Uscn Proteins for PTGES3

    Gene Ontology (GO): 5/6 cellular component terms (GO ID links to tree view) (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000781chromosome, telomeric region IC12135483
    GO:0005634nucleus IDA--
    GO:0005697telomerase holoenzyme complex IDA12135483
    GO:0005730NOT nucleolus IDA--
    GO:0005737cytoplasm IDA--


    PTGES3 for ontologies           About GeneDecksing



    PTGES3 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    OriGene Antibodies (see all 2): PTGES3
    OriGene Custom Antibody Services for PTGES3 
    GenScript Custom Superior Antibodies Services for PTGES3
    Novus Biologicals PTGES3 Antibodies
    Abcam antibodies for PTGES3 
    Uscn Antibodies for PTGES3
    ThermoFisher Antibody for PTGES3

    Assay Products for PTGES3: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for PTGES3
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for PTGES3

    Protein Domains /
    Families
    for PTGES3 gene

    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section
    PTGES3 for domains           About GeneDecksing

    3 InterPro domains/families:
     IPR008978 HSP20-like_chaperone
     IPR017447 CS_domain
     IPR007052 CS-like_domain

    Graphical View of Domain Structure for InterPro Entry Q15185

    ProtoNet protein and cluster: Q15185

    UniProtKB/Swiss-Prot: TEBP_HUMAN, Q15185
    Similarity: Belongs to the p23/wos2 family
    Similarity: Contains 1 CS domain


    Function
    for PTGES3 gene

    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section
    Function Summary:

         UniProtKB/Swiss-Prot: TEBP_HUMAN, Q15185
    Function: Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts
    receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes
    Catalytic activity: (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate =
    (5Z,13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate
    Biophysicochemical properties: Kinetic parameters: KM=14 uM for PGH2; Vmax=190 nmol/min/mg enzyme toward PGH2;

    Enzyme Number (IUBMB): EC 5.3.99.31 2

    miRNA
    Products:            		 OriGene 3'-UTR Clone: PTGES3
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat PTGES3
    8/21 QIAGEN miScript miRNA Assays for microRNAs that regulate PTGES3 (see all 21):
    hsa-miR-4286 hsa-miR-148b hsa-miR-605 hsa-let-7a-2* hsa-miR-301a hsa-let-7g* hsa-miR-186 hsa-miR-548c-3p
    SwitchGear 3'UTR luciferase reporter plasmid: PTGES3 3' UTR sequence
    Inhib. RNA
    Products:            		Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for PTGES3 (see all 4)
    OriGene shRNA RFP: PTGES3
    OriGene siRNA: PTGES3
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat PTGES3

    Gene Editing
    Products:    		DNA2.0 Custom Protein Engineering Service for PTGES3

    Clone
    Products:             		Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for PTGES3 (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for PTGES3
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: PTGES3 (NM_006601)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for PTGES3
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PTGES3 

    Cell Line
    Products:             		GenScript Custom overexpressing Cell Line Services for PTGES3
    Search LifeMap BioReagents cell lines for PTGES3

    In Situ Assay
    Products:       
         		Search Advanced Cell Diagnostics for RNAscope RNA in situ hybridization assays for PTGES3

    Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0003720telomerase activity IDA12135483
    GO:0005515protein binding IPI--
    GO:0050220prostaglandin-E synthase activity IDA10922363
    GO:0051082unfolded protein binding IDA12077419


    PTGES3 for ontologies           About GeneDecksing


    Animal Models:
         Mouse knock-out Ptges3tm1Nkt for PTGES3
         7 MGI mutant phenotypes (inferred from 3 alleles) (MGI details for Ptges3):
     behavior/neurological  cellular  growth/size  homeostasis/metabolism  integument 
     mortality/aging  respiratory system 

    PTGES3 for phenotypes           About GeneDecksing


    Pathways & Interactions
    for PTGES3 gene

    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways  About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
    		Synthesis of Prostaglandins (PG) and Thromboxanes (TX)1.00
    		prostanoid biosynthesis0.50
    2Metabolism
    		Metabolism1.00
    		Metabolism of lipids and lipoproteins0.34
    3Mechanisms of CFTR activation by S-nitrosoglutathione (normal and CF)
    		Development Glucocorticoid receptor signaling0.27
    		Development_Glucocorticoid receptor signaling0.27
    4Arachidonic acid metabolism
    		Arachidonic acid metabolism1.00
    5Regulation of Telomerase
    		Regulation of Telomerase1.00

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    1 EMD Millipore Pathway for PTGES3
        Development Glucocorticoid receptor signaling


    1 GeneGo (Thomson Reuters) Pathway for PTGES3
        Development Glucocorticoid receptor signaling

    2 BioSystems Pathways for PTGES3 
        Regulation of Telomerase
    prostanoid biosynthesis

    4        Reactome Pathways for PTGES3
        Metabolism
    Arachidonic acid metabolism
    Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
    Metabolism of lipids and lipoproteins


    UniProtKB/Swiss-Prot: TEBP_HUMAN, Q15185
    Pathway: Lipid metabolism; prostaglandin biosynthesis


    PTGES3 for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for PTGES3

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/77 Interacting proteins for PTGES3 (Q151851, 3 ENSP000002620334) via UniProtKB, MINT, STRING, and/or I2D (see all 77)

    InteractantInteraction Details
    GeneCardExternal ID(s)
    HSP90AA1P079001, 3, ENSP000003351534EBI-1049387,EBI-2211817 I2D: score=4 STRING: ENSP00000335153
    HSPA1AP081073, ENSP000003648024I2D: score=2 STRING: ENSP00000364802
    NR3C1P041503, ENSP000002315094I2D: score=3 STRING: ENSP00000231509
    NR3C2P082353, ENSP000003508154I2D: score=3 STRING: ENSP00000350815
    AHRP358693, ENSP000002420574I2D: score=2 STRING: ENSP00000242057
    About this table

    Gene Ontology (GO): 5/6 biological process terms (GO ID links to tree view) (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000723telomere maintenance TAS12135483
    GO:0001516prostaglandin biosynthetic process IEA--
    GO:0006692prostanoid metabolic process ----
    GO:0007165signal transduction TAS8114727
    GO:0044281small molecule metabolic process ----


    PTGES3 for ontologies           About GeneDecksing



    Drugs & Compounds
    for PTGES3 gene

    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    PTGES3 for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for PTGES3

    3 HMDB Compounds for PTGES3    About this table
    CompoundSynonyms CAS #PubMed Ids
    PGH3prostaglandin H(,3) 42935-17-1--
    Progesterone17a-Progesterone (see all 114)57-83-0--
    Prostaglandin H1PGH(,1) (see all 3)----
    10/13 Novoseek chemical compound relationships for PTGES3 gene (see all 13)    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    geldanamycin 82.3 7 19751963 (1), 17010336 (1), 8524246 (1), 10939589 (1) (see all 5)
    pgh2 72.7 2 12528468 (1), 19347995 (1)
    pge2 70.9 23 17707523 (2), 17708577 (2), 14675759 (1), 11847219 (1) (see all 15)
    novobiocin 61.5 2 10945979 (1), 15209518 (1)
    prostaglandin 60 9 19347995 (3), 12519887 (1), 12684036 (1), 17697149 (1)
    molybdate 57.2 1 10224120 (1)
    steroid 43.4 18 14507910 (2), 10702249 (2), 9584173 (2), 9001212 (1) (see all 11)
    progesterone 42.3 6 8114727 (2), 10811660 (2), 10364185 (1), 9001212 (1)
    amp-pnp 42.3 2 16403413 (2)
    atp 33.5 14 16403413 (2), 10364185 (2), 12563018 (2), 11809754 (1) (see all 8)

    Search CenterWatch for drugs/clinical trials and news about PTGES3 / TEBP 

    Transcripts
    for PTGES3 gene

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section
    REFSEQ mRNAs for PTGES3 gene: 
    NM_006601.5  

    Unigene Cluster for PTGES3:

    Prostaglandin E synthase 3 (cytosolic)
    Hs.50425  [show with all ESTs]
    Unigene Representative Sequence: AK098214
    7 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000262033(uc001slu.4 uc001slv.4 uc010sqs.2 uc010sqt.2)
    ENST00000537473(uc001slw.4) ENST00000552354 ENST00000414274 ENST00000436399
    ENST00000448157 ENST00000456859

    miRNA
    Products:             		 OriGene 3'-UTR Clone: PTGES3
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat PTGES3
    8/21 QIAGEN miScript miRNA Assays for microRNAs that regulate PTGES3 (see all 21):
    hsa-miR-4286 hsa-miR-148b hsa-miR-605 hsa-let-7a-2* hsa-miR-301a hsa-let-7g* hsa-miR-186 hsa-miR-548c-3p
    SwitchGear 3'UTR luciferase reporter plasmid: PTGES3 3' UTR sequence
    Inhib. RNA
    Products:             		Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for PTGES3 (see all 4)
    OriGene shRNA RFP: PTGES3
    OriGene siRNA: PTGES3
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat PTGES3
    Clone
    Products:             		 OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for PTGES3 (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for PTGES3
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: PTGES3 (NM_006601)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for PTGES3
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PTGES3 
    Primer
    Products:            		 OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for PTGES3
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat PTGES3
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat PTGES3
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat PTGES3

    Additional cDNA sequence: 

    AK098214.1 AK291945.1 AK293139.1 AK295208.1 AK298147.1 AK298160.1 BC003005.1 BC021167.1 
    L24804.1 Z69891.1 

    24/52 DOTS entries (see all 52):

    DT.91676558  DT.97867443  DT.207870  DT.100039355  DT.92378109  DT.99943637  DT.91774220  DT.100888765 
    DT.95131120  DT.121123399  DT.95131133  DT.95364994  DT.100888781  DT.100834310  DT.100888780  DT.100888776 
    DT.100651014  DT.91774194  DT.121123382  DT.92021424  DT.95131123  DT.95131134  DT.99997180  DT.100039357 

    24/1195 AceView cDNA sequences (see all 1195):

    BQ425998 AI440418 BM781803 CN485144 BM977893 BI861717 CB215817 BM703519 
    BQ425469 BF594063 CB135131 AU118653 BP377704 AA740738 AA989481 AL539894 
    BQ223025 BG614731 AW574534 CR597676 CA945216 AA583026 AL559980 D57521 

    GeneLoc Exon Structure

    5 Alternative Splicing Database (ASD) splice patterns (SP) for PTGES3    About this scheme

    ExUns: 1a · 1b · 1c ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7 ^ 8
    SP1:                    -     -     -                       -                           
    SP2:                    -     -     -     -                 -                           
    SP3:                    -     -     -     -                                             
    SP4:                                -     -                                             
    SP5:                                      -                                             


    ECgene alternative splicing isoforms for PTGES3

    Expression
    for PTGES3 gene

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    PTGES3 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: ACAGTGGGGA

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)
    About this image
    See PTGES3 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for PTGES3

    SOURCE GeneReport for Unigene cluster: Hs.50425
        SABiosciences Expression via Pathway-Focused PCR Array including PTGES3: 
              Telomeres & Telomerase in human mouse rat

    Primer
    Products:    		 OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for PTGES3
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat PTGES3
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat PTGES3
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat PTGES3
    In Situ
    Assay Products:     
         		Search Advanced Cell Diagnostics for RNAscope RNA in situ hybridization assays for PTGES3

    Orthologs
    for PTGES3 gene

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section
    This gene was present in the common ancestor of eukaryotes.

    Orthologs for PTGES3 gene from 9/27 species (see all 27)    About this table
    Organism Taxonomic
    classification    		 Gene Description Human
    Similarity    		 Orthology
    Type    		 Details
    mouse
    (Mus musculus)    		 Mammalia Ptges31 , 5 prostaglandin E synthase 3 (cytosolic)1, 5 95(n)1
    98.75(a)1    		   10 (76.39 cM)5
    563511  NM_019766.41  NP_062740.11 
     1280589545 
    chicken
    (Gallus gallus)    		 Aves TEBP_CHICK6
    		 Prostaglandin E synthase 3
    		 96(a)
    		 1 ↔ 1
    		 E22C19W28_E50C23(889294-891982)
    lizard
    (Anolis carolinensis)    		 Reptilia PTGES36
    		 --
    		 93(a)
    		 1 ↔ 1
    		 2(94890180-94894030)
    African clawed frog
    (Xenopus laevis)    		 Amphibia tebp-pending-prov2 unactive progesterone receptor, 23 kD 85.12(n)    BC044075.1 
    zebrafish
    (Danio rerio)    		 Actinopterygii ptges3a1 prostaglandin E synthase 3a (cytosolic) 77.64(n)
    79.11(a)    		   406449  NM_213170.1  NP_998335.1 
    fruit fly
    (Drosophila melanogaster)    		 Insecta CG168176
    		 --
    		 21(a)
    		 1 → many
    		 3R(5503649-5505380)
    worm
    (Caenorhabditis elegans)    		 Secernentea ZC395.106
    		 Uncharacterized protein ZC395.10
    		 21(a)
    		 1 → many
    		 III(5273567-5274748)
    thale cress
    (Arabidopsis thaliana)    		 eudicotyledons AT3G037736
    AT4G024506
    		 HSP20-like chaperone
    		 18(a)
    17(a)
    		 many ↔ many
    many ↔ many
    		 3(951628-953840)
    4(1073753-1075893)
    rice
    (Oryza sativa)    		 Liliopsida --
    --
    (see all 3)    		 co-chaperone protein SBA1, putative, expressed
    (see all 3)    		 26(a)
    21(a)
    (see all 3)    		 many ↔ many
    many ↔ many
    (see all 3)    		 3(25554825-25558858)
    8(16535594-16539985)


    ENSEMBL Gene Tree for PTGES3 (if available)
    TreeFam Gene Tree for PTGES3 (if available) 

    Paralogs
    for PTGES3 gene

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for PTGES3 gene
    AARSD12  PTGES3L2  
    2 SIMAP similar genes for PTGES3 using alignment to 6 protein entries:     TEBP_HUMAN (see all proteins):
    PTGES3L-AARSD1    PTGES3L

    PTGES3 for paralogs           About GeneDecksing


    4 Pseudogenes.org Pseudogenes for PTGES3
    PGOHUM00000238907 PGOHUM00000238912 PGOHUM00000240601 PGOHUM00000245765


    Genomic Variants
    for PTGES3 gene

    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/579 NCBI SNPs in PTGES3 are shown (see all 579)     About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance    		Chr 12 posSequence#AA
    Chg    		TypeMore#Allele
    freq    		PopTotal
    sample    		More
    ----------
    rs1891690781,2
    		--57056739(+) CCACCA/GTGCCG 1 -- int10--------
    rs171188931,2
    		C,F,H,--57056755(+) TATAAT/CGCGTT 1 -- int114Minor allele frequency- C:0.09NA NS EA WA 1454
    rs1452072601,2
    		--57056762(+) CGTTTA/CAAGGC 1 -- int10--------
    rs1418102791,2
    		--57056834(+) ACAAG-/TTTT  
                TTTAA     		1 -- int10--------
    rs1807058251,2
    		--57056877(+) CACATC/TGTAAT 1 -- int10--------
    rs1856089721,2
    		--57056878(+) ACATCC/GTAATA 1 -- int10--------
    rs1905131891,2
    		--57057165(+) TTTCAA/GTCAAA 1 -- ut310--------
    rs10499021,2
    		C--57057185(-) GAAAAG/AAAAGT 1 -- ut312Minor allele frequency- A:0.01MN NA 186
    rs10499001,2
    		C--57057205(-) GATGCA/CCTTTG 1 -- ut313Minor allele frequency- C:0.00MN NA 188
    rs1484731341,2
    		--57057271(+) GCCTCG/TTTTTT 1 -- ut310--------

    HapMap Linkage Disequilibrium report for PTGES3 (57057125 - 57082159 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for PTGES3: --

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing PTGES3
    DNA2.0 Custom Variant and Variant Library Synthesis for PTGES3

    Disorders / Diseases
    for PTGES3 gene

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section
    PTGES3 for disorders           About GeneDecksing

    OMIM gene information: 607061    OMIM disorders: --

    20/24 diseases for PTGES3 (see all 24):    About MalaCards
    intellectual disability    cryptosporidiosis    reticulosarcoma    squamous cell carcinoma
    gastric ulcer    hepatitis c    gastritis    esophageal cancer
    gingivitis    alzheimer's disease    esophagitis    osteoarthritis
    ovarian cancer    gastric cancer    influenza    pancreatic cancer
    colorectal cancer    breast cancer    pancreatitis    hepatitis

    3 Novoseek disease relationships for PTGES3 gene    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    shock 54.6 16 10811660 (2), 12684036 (2), 20226165 (1), 12432931 (1) (see all 11)
    tumors 0 12 19347995 (4), 16809759 (3), 14621192 (1)
    cancer 0 6 17868774 (2), 19412621 (1)

    Human Genome Epidemiology (HuGE) Navigator: PTGES3 (1 document)

    Export disorders for PTGES3 gene to outside databases

    Publications
    for PTGES3 gene

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for PTGES3 gene, integrated from 9 sources (see all 169):
    (articles sorted by number of sources associating them with PTGES3)    		    Utopia: connect your pdf to the dynamic
    world of online information

    1. Characterization of a novel 23-kilodalton protein of unactive progesterone receptor complexes. (PubMed id 8114727)1, 2, 3, 9 Johnson J.L.... Toft D.O. (1994)
    2. Disassembly of transcriptional regulatory complexes by molecular chaperones. (PubMed id 12077419)1, 2, 3 Freeman B.C. and Yamamoto K.R. (2002)
    3. Crystal structure and activity of human p23, a heat shock protein 90 co-chaperone. (PubMed id 10811660)1, 2, 9 Weaver A.J.... Toft D.O. (2000)
    4. Stable association of hsp90 and p23, but Not hsp70, with active human telomerase. (PubMed id 11274138)1, 2, 9 Forsythe H.L....Holt S.E. (2001)
    5. Phosphoproteomic analysis of the human pituitary. (PubMed id 16807684)1, 2 Beranova-Giorgianni S.... Giorgianni F. (2006)
    6. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PubMed id 17081983)1, 2 Olsen J.V....Mann M. (2006)
    7. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    8. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    9. Molecular identification of cytosolic prostaglandin E2 synthase that is functionally coupled with cyclooxygenase-1 in immediate prostaglandin E2 biosynthesis. (PubMed id 10922363)1, 2 Tanioka T.... Kudo I. (2000)
    10. The co-chaperone p23 arrests the Hsp90 ATPase cycle to trap client proteins. (PubMed id 16403413)1, 9 McLaughlin S.H....Jackson S.E. (2006)

    External Searches for PTGES3 gene

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  
      Query String
    		PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    Genome Databases showing PTGES3 gene

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 10728 HGNC: 16049 AceView: TEBP Ensembl:ENSG00000110958 euGenes: HUgn10728
    ECgene: PTGES3 H-InvDB: PTGES3

    Other Databases showing PTGES3 gene

    (According to HUGE)
    About This Section
    		   --

    Specialized Databases showing PTGES3 gene

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for PTGES3 Pharmacogenomics, SNPs, Pathways

    Intellectual Property
    for PTGES3 gene

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    		Patent Information for PTGES3 gene:
    Search GeneIP for patents involving PTGES3

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    Products
    for PTGES3 gene

    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     OriGene Antibodies for PTGES3   OriGene shRNA RFP for PTGES3  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for PTGES3   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for PTGES3  
     OriGene Protein Over-expression Lysate for PTGES3   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for PTGES3   OriGene 3'-UTR Clone for PTGES3  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for PTGES3   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for PTGES3  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     OriGene Purified Protein for PTGES3   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for PTGES3   OriGene Custom Protein Services for PTGES3  
     OriGene Custom Immunoassay Development  

         		 
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat PTGES3
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing PTGES3
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat PTGES3
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat PTGES3
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat PTGES3
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat PTGES3
     GenScript Custom Purified and Recombinant Proteins Services for PTGES3 GenScript cDNA clones with any tag delivered in your preferred vector for PTGES3
     GenScript Custom Assay Services for PTGES3 GenScript Custom Superior Antibodies Services for PTGES3
     GenScript Custom overexpressing Cell Line Services for PTGES3 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in PTGES3 promoter
     Search Chromatin IP Primers for PTGES3
     RT2 qPCR Primer Assay in human, mouse, rat PTGES3
     GNC Network for PTGES3
     SABiosciences PCR Arrays including human, mouse, rat PTGES3
     Search Tocris compounds for PTGES3
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Proteins for PTGES3
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     PTGES3 antibodies
     PTGES3 proteins
     PTGES3 lysates
     Antibodies for PTGES3
     See all of Abcam's Antibodies, Kits and Proteins for PTGES3
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for PTGES3




     PTGES3 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for PTGES3
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Search Advanced Cell Diagnostics for RNAscope RNA in situ hybridization assays for PTGES3
     SwitchGear 3'UTR luciferase reporter plasmids for PTGES3
     SwitchGear Promoter luciferase reporter plasmids for PTGES3
     ThermoFisher Antibody for PTGES3
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PTGES3
           
    GeneCards Homepage - Last full update: 19 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 

    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Copyright © 1996-2013 , Weizmann Institute of Science. All Rights Reserved.
    Hot genes      Disease genes      PTGES3 gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 100 solr: 1.4