Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 



PTGES3 Gene

protein-coding   GIFtS: 65
GCID: GC12M057057

Prostaglandin E Synthase 3 (Cytosolic)

Alzheimer's & Parkinson's Diseases Congress
  See related diseases
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

TryGeneCards Plus

Aliases
Prostaglandin E Synthase 3 (Cytosolic)1 2     Hsp90 Co-Chaperone2 3
P232 3 5     EC 5.3.99.33 8
Cytosolic Prostaglandin E2 Synthase2 3     Cytosolic Prostaglandin E Synthase2
Progesterone Receptor Complex P232 3     Prostaglandin E Synthase 32
Telomerase-Binding Protein P232 3     Unactive Progesterone Receptor, 23 KD2
TEBP2 3     CPGES5
cPGES2 3     

External Ids:    HGNC: 160491   Entrez Gene: 107282   Ensembl: ENSG000001109587   OMIM: 6070615   UniProtKB: Q151853   

Export aliases for PTGES3 gene to outside databases

Previous GC identifers: GC12M055344 GC12M054096


(According to Entrez Gene, GeneCards, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

TryGeneCards Plus

GeneCards Summary for PTGES3 Gene:
PTGES3 (prostaglandin E synthase 3 (cytosolic)) is a protein-coding gene. Diseases associated with PTGES3 include reticulosarcoma, and cryptosporidiosis. GO annotations related to this gene include prostaglandin-E synthase activity and unfolded protein binding. An important paralog of this gene is AARSD1.

UniProtKB/Swiss-Prot: TEBP_HUMAN, Q15185
Function: Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and
disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory
complexes

Gene Wiki entry for PTGES3 Gene


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 75), Regulatory elements and Epigenetics data according to QIAGEN, and/or SwitchGear Genomics)
About This Section

TryGeneCards Plus
RefSeq DNA sequence:
NC_000012.12  NT_029419.13  NC_018923.2  
Regulatory elements:
   Regulatory transcription factor binding sites in the PTGES3 gene promoter:
         MAZR   MIF-1   NF-kappaB   Arnt   C/EBPalpha   CHOP-10   HOXA5   COMP1   ARP-1   NF-kappaB1   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidPTGES3 promoter sequence
   Search Chromatin IP Primers for PTGES3

Epigenetics:
DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat PTGES3


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 12q13.3|12   Ensembl cytogenetic band:  12q13.3   HGNC cytogenetic band: 12q13.13

PTGES3 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
PTGES3 gene location

GeneLoc information about chromosome 12         GeneLoc Exon Structure

GeneLoc location for GC12M057057:  view genomic region     (about GC identifiers)

Start:
57,057,125 bp from pter      End:
57,082,159 bp from pter
Size:
25,035 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, 2neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Antibodies by EMD Millipore, R&D Systems, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

TryGeneCards Plus

UniProtKB/Swiss-Prot: TEBP_HUMAN, Q15185 (See protein sequence)
Recommended Name: Prostaglandin E synthase 3  
Size: 160 amino acids; 18697 Da
Subunit: Binds to the progesterone receptor. Interacts with TERT; the interaction, together with HSP90AA1, is
required for correct assembly and stabilization of the telomerase holoenzyme complex
2 PDB 3D structures from and Proteopedia for PTGES3:
1EJF (3D)        1LG0 (3D)    
Secondary accessions: A8K7D0 Q8WU70

Explore the universe of human proteins at neXtProt for PTGES3: NX_Q15185

Explore proteomics data for PTGES3 at MOPED

Post-translational modifications: 

  • Ubiquitination2 at Lys48, Lys79, Lys95
  • Modification sites at PhosphoSitePlus
  • 3 DME Specific Peptides for PTGES3 (Q15185)
     DVDLPEVDGADDDS  SKHKRTDRSILCCLRKGESGQ  WPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFS 


    See PTGES3 Protein Expression from SPIRE MOPED, PaxDB, and MaxQB

    REFSEQ proteins (6 alternative transcripts): 
    NP_001269530.1  NP_001269531.1  NP_001269532.1  NP_001269533.1  NP_001269534.1  NP_006592.3  

    ENSEMBL proteins: 
     ENSP00000262033   ENSP00000405299   ENSP00000402385   ENSP00000414892   ENSP00000389090  
    Reactome Protein details: Q15185

    PTGES3 Human Recombinant Protein Products:

    Browse Purified and Recombinant Proteins at EMD Millipore
    R&D Systems Recombinant & Natural Proteins for PTGES3 (p23/PTGES3)
    Enzo Life Sciences proteins for PTGES3
    OriGene Purified Protein for PTGES3
    OriGene Protein Over-expression Lysate for PTGES3
    OriGene MassSpec for PTGES3
    OriGene Custom Protein Services for PTGES3
    GenScript Custom Purified and Recombinant Proteins Services for PTGES3
    Novus Biologicals PTGES3 Proteins
    Novus Biologicals PTGES3 Lysate
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates
    ProSpec Recombinant Protein for PTGES3
    Cloud-Clone Corp. Proteins for PTGES3

    PTGES3 Antibody Products:

    EMD Millipore Mono- and Polyclonal Antibodies for the study of PTGES3
    R&D Systems Antibodies for PTGES3 (p23/PTGES3)
    OriGene Antibodies for PTGES3
    OriGene Custom Antibody Services for PTGES3
    Novus Biologicals PTGES3 Antibodies
    Abcam antibodies for PTGES3
    Cloud-Clone Corp. Antibodies for PTGES3
    ThermoFisher Antibody for PTGES3
    LSBio Antibodies in human, mouse, rat for PTGES3

    PTGES3 Assay Products:

    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for PTGES3
    R&D Systems Ubiquitin Proteasome Pathway (UPP) Assay Kits & Reagents for PTGES3 (p23/PTGES3)
    GenScript Custom Assay Services for PTGES3
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for PTGES3
    Cloud-Clone Corp. CLIAs for PTGES3


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    TryGeneCards Plus
    IUPHAR Guide to PHARMACOLOGY protein family classification: cPGES
    Prostaglandin synthases

    2 InterPro protein domains:
     IPR008978 HSP20-like_chaperone
     IPR007052 CS_dom

    Graphical View of Domain Structure for InterPro Entry Q15185

    ProtoNet protein and cluster: Q15185

    UniProtKB/Swiss-Prot: TEBP_HUMAN, Q15185
    Similarity: Belongs to the p23/wos2 family
    Similarity: Contains 1 CS domain


    PTGES3 for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    transcription factor targeting from QIAGEN and/or HOMER, miRNA Gene Targets from miRTarBase, shRNA from OriGene, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, SwitchGear Genomics, Gene Editing from DNA2.0, Clones from OriGene, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, ESI BIO, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: TEBP_HUMAN, Q15185
    Function: Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and
    disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory
    complexes
    Catalytic activity: (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15-hydroxyprosta-5,13-dienoate =
    (5Z,13E)-(15S)-11-alpha,15-dihydroxy-9-oxoprosta-5,13-dienoate
    Biophysicochemical properties: Kinetic parameters: KM=14 uM for PGH2; Vmax=190 nmol/min/mg enzyme toward PGH2;

         Enzyme Number (IUBMB): EC 5.3.99.31 2

         Gene Ontology (GO): 4 molecular function terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0003720telomerase activity IDA12135483
    GO:0005515protein binding IPI19875381
    GO:0050220prostaglandin-E synthase activity IDA10922363
    GO:0051082unfolded protein binding IDA12077419
         
    PTGES3 for ontologies           About GeneDecksing


    Phenotypes:
         7 MGI mutant phenotypes (inferred from 3 alleles(MGI details for Ptges3):
     behavior/neurological  cellular  growth/size/body  homeostasis/metabolism  integument 
     mortality/aging  respiratory system 

    PTGES3 for phenotypes           About GeneDecksing

    Animal Models:
         MGI mouse knock-out Ptges3tm1Nkt for PTGES3

       inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for PTGES3
       inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for PTGES3

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for PTGES3
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for PTGES3

    miRNA
    Products:
        
    miRTarBase miRNAs that target PTGES3:
    hsa-mir-744-5p (MIRT037524)

    Block miRNA regulation of human, mouse, rat PTGES3 using miScript Target Protectors
    Selected qRT-PCR Assays for microRNAs that regulate PTGES3 (see all 21):
    hsa-miR-4286 hsa-miR-148b hsa-miR-605 hsa-let-7a-2* hsa-miR-301a hsa-let-7g* hsa-miR-186 hsa-miR-548c-3p
    SwitchGear 3'UTR luciferase reporter plasmidPTGES3 3' UTR sequence
    Inhib. RNA
    Products:
        
    OriGene RNAi products in human, mouse, rat for PTGES3
    Predesigned siRNA for gene silencing in human, mouse, rat PTGES3

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for PTGES3

    Clone
    Products:
         
    OriGene clones in human, mouse for PTGES3 (see all 6)
    OriGene ORF clones in mouse, rat for PTGES3
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: PTGES3 (NM_006601)
    Sino Biological Human cDNA Clone for PTGES3
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for PTGES3
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PTGES3

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for PTGES3
    Browse ESI BIO Cell Lines and PureStem Progenitors for PTGES3 
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for PTGES3


    (According to UniProtKB, COMPARTMENTS Subcellular localization database, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Subcellular locations from UniProtKB/Swiss-Prot
    TEBP_HUMAN, Q15185: Cytoplasm
    Subcellular locations from COMPARTMENTS: 

    CompartmentConfidence
    nucleus5
    cytosol4
    extracellular1
    golgi apparatus1

    Gene Ontology (GO): Selected cellular component terms (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000781chromosome, telomeric region IC12135483
    GO:0005634nucleus IDA--
    GO:0005697telomerase holoenzyme complex IDA12135483
    GO:0005730NOT nucleolus IDA--
    GO:0005737cytoplasm IDA--

    PTGES3 for ontologies           About GeneDecksing


    (SuperPaths according to PathCards, Pathways according to R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to QIAGEN, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene).
    About This Section

    TryGeneCards Plus

    SuperPaths for PTGES3 About                                                                                                See pathways by source

    SuperPathContained pathways About
    1Arachidonic acid metabolism
    Arachidonic acid metabolism0.41
    Synthesis of Prostaglandins (PG) and Thromboxanes (TX)0.00
    Arachidonic acid metabolism0.40
    C20 prostanoid biosynthesis0.00
    2Metabolism
    Metabolism0.38
    Metabolism of lipids and lipoproteins0.37
    Metabolic pathways0.38
    3Regulation of Telomerase
    Regulation of Telomerase
    4Development Glucocorticoid receptor signaling
    Development Glucocorticoid receptor signaling
    5AhR pathway (WikiPathways)
    AhR pathway

    Pathways by source                                                                                                                                                                 See SuperPaths
    Show all pathways

    3 Downloadable PowerPoint Slides of GeneGlobe Pathway Central Maps for PTGES3
        AHR Pathway
    Telomerase Components in Cell Signaling
    Glucocorticoid Receptor Signaling

    1 GeneGo (Thomson Reuters) Pathway for PTGES3
        Development Glucocorticoid receptor signaling

    3 BioSystems Pathways for PTGES3
        C20 prostanoid biosynthesis
    AhR pathway
    Regulation of Telomerase


    3 Reactome Pathways for PTGES3
        HSF1 activation
    Attenuation phase
    Synthesis of Prostaglandins (PG) and Thromboxanes (TX)


    2 Kegg Pathways  (Kegg details for PTGES3):
        Arachidonic acid metabolism
    Metabolic pathways

    UniProtKB/Swiss-Prot: TEBP_HUMAN, Q15185
    Pathway: Lipid metabolism; prostaglandin biosynthesis


    PTGES3 for pathways           About GeneDecksing

        Pathway & Disease-focused RT2 Profiler PCR Array including PTGES3: 

              Telomeres & Telomerase in human mouse rat

    Interactions:

        GeneGlobe Interaction Network for PTGES3

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    Selected Interacting proteins for PTGES3 (Q151851, 3 ENSP000002620334) via UniProtKB, MINT, STRING, and/or I2D (see all 308)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    HSPA1AP081073, ENSP000003648024I2D: score=2 STRING: ENSP00000364802
    ENSG00000212866P081073I2D: score=2 
    ENSG00000215328P081073I2D: score=2 
    ENSG00000224501P081073I2D: score=2 
    ENSG00000231555P081073I2D: score=2 
    About this table

    Gene Ontology (GO): Selected biological process terms (see all 8):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000723telomere maintenance TAS12135483
    GO:0001516prostaglandin biosynthetic process IDA10922363
    GO:0006278RNA-dependent DNA replication IDA12135483
    GO:0007165signal transduction TAS8114727
    GO:0019369arachidonic acid metabolic process TAS--

    PTGES3 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience, ApexBio, HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB)
    About This Section

    TryGeneCards Plus
    Browse Small Molecules at EMD Millipore
       Browse drugs & compounds from Enzo Life Sciences
      Browse compounds at ApexBio 

    Browse Tocris compounds for PTGES3 (TEBP)

    3 HMDB Compounds for PTGES3    About this table
    CompoundSynonyms CAS #PubMed Ids
    PGH3prostaglandin H(,3) 42935-17-1--
    Progesterone17a-Progesterone (see all 114)57-83-0--
    Prostaglandin H1PGH(,1) (see all 3)----

    Selected Novoseek inferred chemical compound relationships for PTGES3 gene (see all 13)    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    geldanamycin 82.3 7 19751963 (1), 17010336 (1), 8524246 (1), 10939589 (1) (see all 5)
    pgh2 72.7 2 12528468 (1), 19347995 (1)
    pge2 70.9 23 17707523 (2), 17708577 (2), 14675759 (1), 11847219 (1) (see all 15)
    novobiocin 61.5 2 10945979 (1), 15209518 (1)
    prostaglandin 60 9 19347995 (3), 12519887 (1), 12684036 (1), 17697149 (1)
    molybdate 57.2 1 10224120 (1)
    steroid 43.4 18 14507910 (2), 10702249 (2), 9584173 (2), 9001212 (1) (see all 11)
    progesterone 42.3 6 8114727 (2), 10811660 (2), 10364185 (1), 9001212 (1)
    amp-pnp 42.3 2 16403413 (2)
    atp 33.5 14 16403413 (2), 10364185 (2), 12563018 (2), 11809754 (1) (see all 8)



    PTGES3 for compounds           About GeneDecksing



    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN, SwitchGear Genomics,
    Tagged/untagged cDNA clones from OriGene, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, and/or QIAGEN )
    About This Section

    TryGeneCards Plus

    REFSEQ mRNAs for PTGES3 gene (6 alternative transcripts): 
    NM_001282601.1  NM_001282602.1  NM_001282603.1  NM_001282604.1  NM_001282605.1  NM_006601.6  

    Unigene Cluster for PTGES3:

    Prostaglandin E synthase 3 (cytosolic)
    Hs.50425  [show with all ESTs]
    Unigene Representative Sequence: AK098214
    6 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000262033(uc001slu.4 uc001slv.4 uc010sqs.2 uc010sqt.2)
    ENST00000537473(uc001slw.4) ENST00000414274 ENST00000436399 ENST00000448157
    ENST00000456859

    miRNA
    Products:
         
    Block miRNA regulation of human, mouse, rat PTGES3 using miScript Target Protectors
    Selected qRT-PCR Assays for microRNAs that regulate PTGES3 (see all 21):
    hsa-miR-4286 hsa-miR-148b hsa-miR-605 hsa-let-7a-2* hsa-miR-301a hsa-let-7g* hsa-miR-186 hsa-miR-548c-3p
    SwitchGear 3'UTR luciferase reporter plasmidPTGES3 3' UTR sequence
    Inhib. RNA
    Products:
         
    OriGene RNAi products in human, mouse, rat for PTGES3
    Predesigned siRNA for gene silencing in human, mouse, rat PTGES3
    Clone
    Products:
         
    OriGene clones in human, mouse for PTGES3 (see all 6)
    OriGene ORF clones in mouse, rat for PTGES3
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: PTGES3 (NM_006601)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for PTGES3
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PTGES3
    Primer
    Products:
        
    OriGene qPCR primer pairs and template standards for PTGES3
    OriGene qSTAR qPCR primer pairs in human, mouse for PTGES3
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat PTGES3
      QuantiTect SYBR Green Assays in human, mouse, rat PTGES3
      QuantiFast Probe-based Assays in human, mouse, rat PTGES3

    Additional mRNA sequence: 

    AK098214.1 AK291945.1 AK293139.1 AK295208.1 AK298147.1 AK298160.1 BC003005.1 BC021167.1 
    L24804.1 Z69891.1 

    Selected DOTS entries (see all 52):

    DT.91676558  DT.97867443  DT.207870  DT.100039355  DT.92378109  DT.99943637  DT.91774220  DT.100888765 
    DT.95131120  DT.121123399  DT.95131133  DT.95364994  DT.100888781  DT.100834310  DT.100888780  DT.100888776 
    DT.100651014  DT.91774194  DT.121123382  DT.92021424  DT.95131123  DT.95131134  DT.99997180  DT.100039357 

    Selected AceView cDNA sequences (see all 1195):

    BU167210 BU685462 BG572733 BM463572 BQ946799 AA347785 BQ436586 BM452053 
    BQ223072 AA600219 BU856609 BM787245 AI625532 AI890350 BG528623 BQ962456 
    AW073119 BM788021 BU687938 AV652966 BM479208 AW246426 AA553865 CR610732 

    GeneLoc Exon Structure

    5 Alternative Splicing Database (ASD) splice patterns (SP) for PTGES3    About this scheme

    ExUns: 1a · 1b · 1c ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7 ^ 8
    SP1:                    -     -     -                       -                           
    SP2:                    -     -     -     -                 -                           
    SP3:                    -     -     -     -                                             
    SP4:                                -     -                                             
    SP5:                                      -                                             


    ECgene alternative splicing isoforms for PTGES3

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MaxQB, plus additional links to SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from QIAGEN, Primers from OriGene, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TryGeneCards Plus

    PTGES3 expression in normal human tissues (normalized intensities)      PTGES3 embryonic expression: see
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: ACAGTGGGGA
    PTGES3 Expression
    About this image


    PTGES3 expression in embryonic tissues and stem cells    About this table
    Data from LifeMap, the Embryonic Development and Stem Cells Database
     selected tissues (see all 19) fully expand
     
     Ovary (Reproductive System)    fully expand to see all 2 entries
             Ovarian Mesenchymal Stroma Cells Ovary Interstitium
             Oviduct
     
     Brain (Nervous System)
             Cerebral Cortex
     
     Bone (Muscoskeletal System)
             Bone Marrow
     
     Pancreas (Endocrine System)
             Islets of Langerhans
     
     Colon (Gastrointestinal Tract)
    PTGES3 Protein expression data from MOPED1, PaxDb2 and MaxQB3    About this image

    PTGES3 Protein Expression

    SOURCE GeneReport for Unigene cluster: Hs.50425
        Pathway & Disease-focused RT2 Profiler PCR Array including PTGES3: 
              Telomeres & Telomerase in human mouse rat

    Primer
    Products:
    OriGene qPCR primer pairs and template standards for PTGES3
    OriGene qSTAR qPCR primer pairs in human, mouse for PTGES3
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat PTGES3
    QuantiTect SYBR Green Assays in human, mouse, rat PTGES3
    QuantiFast Probe-based Assays in human, mouse, rat PTGES3
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for PTGES3

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    TryGeneCards Plus

    This gene was present in the common ancestor of animals and fungi.

    Orthologs for PTGES3 gene from Selected species (see all 16)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Ptges31 , 5 prostaglandin E synthase 3 (cytosolic)1, 5 94.97(n)1
    98.74(a)1
      10 (76.39 cM)5
    563511  NM_019766.41  NP_062740.11 
     1280589545 
    chicken
    (Gallus gallus)
    Aves PTGES31 prostaglandin E synthase 3-like 90.15(n)
    96.23(a)
      100859133  NM_001276306.2  NP_001263235.1 
    lizard
    (Anolis carolinensis)
    Reptilia PTGES36
    prostaglandin E synthase 3 (cytosolic)
    94(a)
    1 ↔ 1
    2(94890180-94906645)
    African clawed frog
    (Xenopus laevis)
    Amphibia tebp-pending-prov2 unactive progesterone receptor, 23 kD 85.12(n)    BC044075.1 
    zebrafish
    (Danio rerio)
    Actinopterygii ptges3a1 prostaglandin E synthase 3a (cytosolic) 77.28(n)
    78.34(a)
      406449  NM_213170.1  NP_998335.1 
    worm
    (Caenorhabditis elegans)
    Secernentea ZC395.106
    Protein ZC395.10 (ZC395.10) mRNA, complete cds
    25(a)
    1 → many
    III(5273606-5274787) WBGene00022599
    baker's yeast
    (Saccharomyces cerevisiae)
    Saccharomycetes --
    Putative protein of unknown function with strong s...
    4(a)
    1 → many
    XIV(553380-554750) YNL040W


    ENSEMBL Gene Tree for PTGES3 (if available)
    TreeFam Gene Tree for PTGES3 (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section

    TryGeneCards Plus
    Paralogs for PTGES3 gene
    AARSD12  PTGES3L-AARSD12  PTGES3L2  
    2 SIMAP similar genes for PTGES3 using alignment to 6 protein entries:     TEBP_HUMAN (see all proteins):
    PTGES3L-AARSD1    PTGES3L

    PTGES3 for paralogs           About GeneDecksing


    4 Pseudogenes.org Pseudogenes for PTGES3
    PGOHUM00000238907 PGOHUM00000238912 PGOHUM00000240601 PGOHUM00000245765


    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD), the Human Cytochrome P450 Allele Nomenclature Database, and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers, Cancer Mutation PCR Arrays and Assays, and Copy Number PCR Arrays from QIAGEN)
    About This Section

    TryGeneCards Plus

    Selected SNPs for PTGES3 (see all 734)    About this table    
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 12 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1891690781,2
    --57056739(+) CCACCA/GTGCCG 1 -- int10--------
    rs171188931,2
    C,F,H--57056755(+) TATAAT/CGCGTT 1 -- int114Minor allele frequency- C:0.09NA NS EA WA 1454
    rs1452072601,2
    --57056762(+) CGTTTA/CAAGGC 1 -- int10--------
    rs1418102791,2
    C--57056834(+) ACAAG-/TTTT  
            
    TTTAA
    1 -- int10--------
    rs1807058251,2
    --57056877(+) CACATC/TGTAAT 1 -- int10--------
    rs1856089721,2
    --57056878(+) ACATCC/GTAATA 1 -- int10--------
    rs1905131891,2
    --57057165(+) TTTCAA/GTCAAA 1 -- ut310--------
    rs10499021,2
    C--57057185(-) GAAAAG/AAAAGT 1 -- ut312Minor allele frequency- A:0.01MN NA 186
    rs10499001,2
    C--57057205(-) GATGCA/CCTTTG 1 -- ut313Minor allele frequency- C:0.00MN NA 188
    rs1484731341,2
    --57057271(+) GCCTCG/TTTTTT 1 -- ut310--------

    HapMap Linkage Disequilibrium report for PTGES3 (57057125 - 57082159 bp)

    Structural Variations
          Database of Genomic Variants (DGV) variations for PTGES3: --
    Site Specific Mutation Identification with PCR Assays
    SeqTarget long-range PCR primers for resequencing PTGES3
    DNA2.0 Custom Variant and Variant Library Synthesis for PTGES3

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    TryGeneCards Plus
    OMIM gene information: 607061    OMIM disorders: --

    Selected diseases for PTGES3 (see all 30):    About MalaCards
    reticulosarcoma    cryptosporidiosis    gastric ulcer    gastritis
    intellectual disability    gingivitis    esophageal cancer    age related macular degeneration
    osteoarthritis    lymphoblastic leukemia    influenza    hepatitis c virus
    esophagitis    cystic fibrosis    hepatitis c    hypoxia
    pancreatic cancer    pancreatitis    ovarian cancer    squamous cell carcinoma


    PTGES3 for disorders           About GeneDecksing


    Congresses - knowledge worth sharing:
    The International Symposium on Pneumococci and Pneumococcal Diseases (ISPPD) 9 - 13 March 2014
    Alzheimer's & Parkinson's Diseases Congress (ADPD) 18 - 22 March 2015

    3 Novoseek inferred disease relationships for PTGES3 gene    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    shock 54.6 16 10811660 (2), 12684036 (2), 20226165 (1), 12432931 (1) (see all 11)
    tumors 0 12 19347995 (4), 16809759 (3), 14621192 (1)
    cancer 0 6 17868774 (2), 19412621 (1)

    Genetic Association Database (GAD): PTGES3
    Human Genome Epidemiology (HuGE) Navigator: PTGES3 (1 document)

    Export disorders for PTGES3 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    TryGeneCards Plus

    PubMed articles for PTGES3 gene, integrated from 10 sources (see all 191):
    (articles sorted by number of sources associating them with PTGES3)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Characterization of a novel 23-kilodalton protein of unactive progesterone receptor complexes. (PubMed id 8114727)1, 2, 3, 9 Johnson J.L.... Toft D.O. (Mol. Cell. Biol. 1994)
    2. Disassembly of transcriptional regulatory complexes by molecular chaperones. (PubMed id 12077419)1, 2, 3 Freeman B.C. and Yamamoto K.R. (Science 2002)
    3. Crystal structure and activity of human p23, a heat shock protein 90 co-chaperone. (PubMed id 10811660)1, 2, 9 Weaver A.J.... Toft D.O. (J. Biol. Chem. 2000)
    4. Stable association of hsp90 and p23, but Not hsp70, with active human telomerase. (PubMed id 11274138)1, 2, 9 Forsythe H.L.... Holt S.E. (J. Biol. Chem. 2001)
    5. Genetic variants near TIMP3 and high-density lipoprotein-associated loci influence susceptibility to age-related macular degeneration. (PubMed id 20385819)1, 4 Chen W....Swaroop A. (Proc. Natl. Acad. Sci. U.S.A. 2010)
    6. The glucocorticoid receptor heterocomplex gene STIP1 is associated with improved lung function in asthmatic subjects treated with inhaled corticosteroids. (PubMed id 19254810)1, 4 Hawkins G.A....Bleecker E.R. (J. Allergy Clin. Immunol. 2009)
    7. Phosphoproteomic analysis of the human pituitary. (PubMed id 16807684)1, 2 Beranova-Giorgianni S.... Giorgianni F. (Pituitary 2006)
    8. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PubMed id 17081983)1, 2 Olsen J.V....Mann M. (Cell 2006)
    9. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (Nat. Genet. 2004)
    10. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S.... Malek J. (Genome Res. 2004)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section

    TryGeneCards Plus
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section

    TryGeneCards Plus
    Entrez Gene: 10728 HGNC: 16049 AceView: TEBP Ensembl:ENSG00000110958 euGenes: HUgn10728
    ECgene: PTGES3 Kegg: 10728 H-InvDB: PTGES3

    (According to HUGE)
    About This Section

    TryGeneCards Plus
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL, and/or others, e.g. Wikipedia and GeneReviews, via UniProtKB/Swiss-Prot)
    About This Section

    TryGeneCards Plus
    NameDescription
    PharmGKB entry for PTGES3 Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section

    TryGeneCards Plus
    Patent Information for PTGES3 gene:
    Search GeneIP for patents involving PTGES3

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0. Clones from OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript, and ESI BIO, PCR Arrays from QIAGEN, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, Enzo Life Sciences, and/or ApexBio, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

    TryGeneCards Plus

     Browse Kits and Assays available from EMD Millipore
     Browse Purified and Recombinant Proteins at EMD Millipore
     EMD Millipore Mono- and Polyclonal Antibodies for the study of PTGES3
     Browse Small Molecules at EMD Millipore
     
     EMD Millipore genomic analysis products

      
     Antibodies for PTGES3 (p23/PTGES3)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Enzyme Activity Assays/Reagents  
     Browse ELISpot/FluoroSpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents for PTGES3 (p23/PTGES3)  
     Browse DNA Damage/Repair Kits/Reagents   Browse Luminex Assays  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Recombinant/Natural Proteins for PTGES3 (p23/PTGES3)   Browse Stem Cell Products  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     OriGene Antibodies for PTGES3   OriGene RNAi products in human, mouse, rat for PTGES3  
     OriGene qPCR primer pairs and template standards for PTGES3   OriGene Protein Over-expression Lysate for PTGES3  
     OriGene MassSpec something-or-other for PTGES3   OriGene clones in human, mouse for PTGES3  
     OriGene qSTAR qPCR primer pairs in human, mouse for PTGES3   OriGene Purified Protein for PTGES3  
     OriGene ORF clones in mouse, rat for PTGES3   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for PTGES3   OriGene Custom Protein Services for PTGES3  

     
     
     Block miRNA regulation of human, mouse, rat PTGES3 using miScript Target Protectors SeqTarget long-range PCR primers for resequencing PTGES3
     DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat PTGES3 Predesigned siRNA for gene silencing in human, mouse, rat PTGES3
     QuantiFast Probe-based Assays in human, mouse, rat PTGES3 QuantiTect SYBR Green Assays in human, mouse, rat PTGES3
     PCR Arrays including human, mouse, rat PTGES3 Search Chromatin IP Primers for PTGES3
     Pre-validated RT2 qPCR Primer Assay in human, mouse, rat PTGES3  GeneGlobe Interaction Network for PTGES3
     Regulatory tfbs in PTGES3 promoter
     GenScript Custom Purified and Recombinant Proteins Services for PTGES3 GenScript cDNA clones with any tag delivered in your preferred vector for PTGES3
     GenScript Custom Assay Services for PTGES3 GenScript Custom overexpressing Cell Line Services for PTGES3
     CloneReady with Over 120,000 Genes  Gene Synthesis: Any Gene in Any Vector
     Vector-based siRNA and miRNA, Ready for Transfection Gene Mutant Library, Variants up to 10^11
     Plasmid Preparation Custom Peptide Services
     Search for Antibodies & Assays

     Search Tocris compounds for PTGES3 (TEBP)
     Browse Sino Biological Proteins
     Browse Sino Biological Cell Lysates
     cDNA Clones for PTGES3
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Proteins for PTGES3
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies

     Novus Tissue Slides
     PTGES3 antibodies
     PTGES3 proteins
     PTGES3 lysates
     Antibodies for PTGES3
     See all of Abcam's Antibodies, Kits and Proteins for PTGES3
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for PTGES3
     Proteins for PTGES3
     Antibodies for PTGES3
     ELISAs for PTGES3
     CLIAs for PTGES3



     Browse ESI BIO Cell Lines and PureStem Progenitors for PTGES3
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for PTGES3
     SwitchGear 3'UTR luciferase reporter plasmids for PTGES3
     SwitchGear Promoter luciferase reporter plasmids for PTGES3
     ThermoFisher Antibody for PTGES3
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PTGES3
     inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for PTGES3
     inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for PTGES3
     LSBio Antibodies in human, mouse, rat for PTGES3
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
     Browse compounds at ApexBio
           
    GeneCards Homepage - Last full update: 7 May 2014 - Incrementals: 9 May 2014 , 2 Jun 2014 , 26 Jun 2014 , 30 Jun 2014

    View Random Gene

    Category
    (GIFtS: )
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      PTGES3 gene at Home site.
    Version: 3.12.136 22 July 2014
    hostname: 356977-web1.xennexinc.com index build: 126 solr: 1.4