Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PSMB1 Gene

Aliases for PSMB1 Gene

  • Proteasome Subunit Beta 1 2 3 5
  • Proteasome (Prosome, Macropain) Subunit, Beta Type, 1 2 3
  • Multicatalytic Endopeptidase Complex Subunit C5 3 4
  • Proteasome Component C5 3 4
  • Proteasome Gamma Chain 3 4
  • Macropain Subunit C5 3 4
  • EC 3.4.25.1 4 58
  • PSC5 3 4
  • Testicular Secretory Protein Li 45 3
  • Proteasome Subunit Beta Type-1 3
  • Proteasome Beta 1 Subunit 3
  • Proteasome Subunit HC5 3
  • PMSB1 3
  • HC5 3

External Ids for PSMB1 Gene

Previous GeneCards Identifiers for PSMB1 Gene

  • GC06M170039
  • GC06M170459
  • GC06M170700
  • GC06M170761
  • GC06M168349
  • GC06M170844

Summaries for PSMB1 Gene

Entrez Gene Summary for PSMB1 Gene

  • The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is tightly linked to the TBP (TATA-binding protein) gene in human and in mouse, and is transcribed in the opposite orientation in both species. [provided by RefSeq, Jul 2008]

GeneCards Summary for PSMB1 Gene

PSMB1 (Proteasome Subunit Beta 1) is a Protein Coding gene. Diseases associated with PSMB1 include Diabetes Mellitus, Insulin-Dependent, 8 and Cystic Fibrosis. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and RET signaling. GO annotations related to this gene include threonine-type endopeptidase activity.

UniProtKB/Swiss-Prot for PSMB1 Gene

  • Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Gene Wiki entry for PSMB1 Gene

Additional gene information for PSMB1 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PSMB1 Gene

Genomics for PSMB1 Gene

Regulatory Elements for PSMB1 Gene

Enhancers for PSMB1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH06H170582 1.1 ENCODE 24.1 -31.5 -31515 4 HDGF PKNOX1 MLX ARNT ARID4B SIN3A DMAP1 YY1 ZNF766 ZNF143 PSMB1 TBP PDCD2 PIR58046
GH06H170551 1.4 ENCODE dbSUPER 11.5 -0.3 -310 5 HDGF PKNOX1 FOXA2 MLX ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 TBP ENSG00000266896 PDCD2 WDR27 FAM120B PSMB1 ERMARD
GH06H170521 0.8 ENCODE dbSUPER 17.4 +29.6 29588 3 CTCF RAD51 POLR2A GATA2 IKZF1 USF2 RAD21 PSMB1 TBP DLL1 FAM120B ERMARD TCTE3 PDCD2 PIR55352 PIR48716
GH06H169750 1.1 ENCODE 10.8 +801.5 801507 3 HDGF PKNOX1 FOXA2 MLX ARNT ZFP64 ARID4B SIN3A DMAP1 YY1 TBP WDR27 FAM120B ENSG00000266896 PDCD2 ERMARD PSMB1 ENSG00000236173 LINC02519
GH06H170222 1 Ensembl ENCODE 11.6 +328.6 328570 3 FOXA2 PKNOX1 SIN3A MAX RAD21 YY1 E2F1 GATA3 POLR2A MCM3 ENSG00000266896 PDCD2 TBP PHF10 WDR27 PSMB1 ENSG00000225532 RPL12P23 LOC154449
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PSMB1 on UCSC Golden Path with GeneCards custom track

Promoters for PSMB1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000207329 -259 3201 HDGF PKNOX1 FOXA2 MLX ZFP64 ARID4B SIN3A DMAP1 ZNF2 YY1

Genomic Location for PSMB1 Gene

Chromosome:
6
Start:
170,535,116 bp from pter
End:
170,553,341 bp from pter
Size:
18,226 bases
Orientation:
Minus strand

Genomic View for PSMB1 Gene

Genes around PSMB1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PSMB1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PSMB1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PSMB1 Gene

Proteins for PSMB1 Gene

  • Protein details for PSMB1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P20618-PSB1_HUMAN
    Recommended name:
    Proteasome subunit beta type-1
    Protein Accession:
    P20618
    Secondary Accessions:
    • B5BU76
    • Q9BWA8

    Protein attributes for PSMB1 Gene

    Size:
    241 amino acids
    Molecular mass:
    26489 Da
    Quaternary structure:
    • The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is a barrel-shaped complex made of 28 subunits that are arranged in four stacked rings. The two outer rings are each formed by seven alpha subunits, and the two inner rings are formed by seven beta subunits. The proteolytic activity is exerted by three beta-subunits PSMB5, PSMB6 and PSMB7. Interacts with SERPINB2 (PubMed:14732874). Interacts with HIV-1 TAT protein (PubMed:14550573).

    Three dimensional structures from OCA and Proteopedia for PSMB1 Gene

neXtProt entry for PSMB1 Gene

Selected DME Specific Peptides for PSMB1 Gene

P20618:
  • VASDTRLSEG
  • TVIGCSGFHGDCLTLTKIIEARLKMYKHSNNK
  • LAIAGEDF
  • RDSPKCYKLTD
  • KAGGSASAMLQPLLDNQ
  • YSFDPVGSY
  • GAIAAMLSTILY
  • FISAAERD

Post-translational modifications for PSMB1 Gene

  • Ubiquitination at Lys77, isoforms=94, Lys164, isoforms=184, Lys204, and isoforms=228
  • Glycosylation at Ser58 and Ser209
  • Modification sites at PhosphoSitePlus

Other Protein References for PSMB1 Gene

ENSEMBL proteins:
REFSEQ proteins:

Domains & Families for PSMB1 Gene

Gene Families for PSMB1 Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • FDA approved drug targets
  • Plasma proteins
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for PSMB1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P20618

UniProtKB/Swiss-Prot:

PSB1_HUMAN :
  • Belongs to the peptidase T1B family.
Family:
  • Belongs to the peptidase T1B family.
genes like me logo Genes that share domains with PSMB1: view

Function for PSMB1 Gene

Molecular function for PSMB1 Gene

GENATLAS Biochemistry:
multicatalytic proteinase complex (20S) proteasome (prosome,macropain) component,beta type 1,subunit HC5,26kDa
UniProtKB/Swiss-Prot CatalyticActivity:
Cleavage of peptide bonds with very broad specificity.
UniProtKB/Swiss-Prot Function:
Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).

Enzyme Numbers (IUBMB) for PSMB1 Gene

Gene Ontology (GO) - Molecular Function for PSMB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004175 endopeptidase activity IEA --
GO:0004298 threonine-type endopeptidase activity IEA --
GO:0005515 protein binding IPI 14733938
GO:0008233 peptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with PSMB1: view
genes like me logo Genes that share phenotypes with PSMB1: view

Animal Model Products

CRISPR Products

miRNA for PSMB1 Gene

miRTarBase miRNAs that target PSMB1

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PSMB1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PSMB1 Gene

Localization for PSMB1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PSMB1 Gene

Cytoplasm. Nucleus.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PSMB1 gene
Compartment Confidence
extracellular 5
nucleus 5
cytosol 5
cytoskeleton 2

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PSMB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000502 proteasome complex TAS,IDA 17323924
GO:0005576 extracellular region TAS --
GO:0005634 nucleus IDA 21630459
GO:0005654 nucleoplasm TAS --
GO:0005737 cytoplasm IEA --
genes like me logo Genes that share ontologies with PSMB1: view

Pathways & Interactions for PSMB1 Gene

SuperPathways for PSMB1 Gene

SuperPathway Contained pathways
1 CDK-mediated phosphorylation and removal of Cdc6
.78
.31
2 RET signaling
3 Chks in Checkpoint Regulation
4 HIV Life Cycle
.45
5 Class I MHC mediated antigen processing and presentation
genes like me logo Genes that share pathways with PSMB1: view

Gene Ontology (GO) - Biological Process for PSMB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000165 MAPK cascade TAS --
GO:0000209 protein polyubiquitination TAS --
GO:0002223 stimulatory C-type lectin receptor signaling pathway TAS --
GO:0002479 antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent TAS --
GO:0006508 proteolysis IEA --
genes like me logo Genes that share ontologies with PSMB1: view

No data available for SIGNOR curated interactions for PSMB1 Gene

Drugs & Compounds for PSMB1 Gene

(7) Drugs for PSMB1 Gene - From: DrugBank, DGIdb, and FDA Approved Drugs

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Bortezomib Approved, Investigational Pharma inhibitor, other, Target Proteosome and NF-kappaB inhibitor, Other, Proteasome inhibitors 814
carfilzomib Approved Pharma other, Inhibitor, Target Other, 20S Proteasome Inhibitor 0
Kyprolis Approved July 2012 Pharma 0
Velcade Approved May 2003 Pharma 0
(3AR,6R,6AS)-6-((S)-((S)-CYCLOHEX-2-ENYL)(HYDROXY)METHYL)-6A-METHYL-4-OXO-HEXAHYDRO-2H-FURO[3,2-C]PYRROLE-6-CARBALDEHYDE Experimental Pharma Target 0
genes like me logo Genes that share compounds with PSMB1: view

Transcripts for PSMB1 Gene

mRNA/cDNA for PSMB1 Gene

Unigene Clusters for PSMB1 Gene

Proteasome (prosome, macropain) subunit, beta type, 1:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PSMB1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for PSMB1 Gene

ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b · 3c ^ 4 ^ 5 ^ 6 ^ 7a · 7b · 7c
SP1: - -
SP2: - - -
SP3: - - -
SP4:
SP5:

Relevant External Links for PSMB1 Gene

GeneLoc Exon Structure for
PSMB1
ECgene alternative splicing isoforms for
PSMB1

Expression for PSMB1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PSMB1 Gene

Protein differential expression in normal tissues from HIPED for PSMB1 Gene

This gene is overexpressed in Liver, secretome (7.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PSMB1 Gene



Protein tissue co-expression partners for PSMB1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PSMB1 Gene:

PSMB1

SOURCE GeneReport for Unigene cluster for PSMB1 Gene:

Hs.352768

Evidence on tissue expression from TISSUES for PSMB1 Gene

  • Lung(4.8)
  • Nervous system(4.8)
  • Kidney(3)
  • Intestine(2.9)
  • Liver(2.8)
  • Blood(2.3)
  • Skin(2.3)
  • Pancreas(2.2)
  • Adrenal gland(2)
  • Heart(2)
  • Lymph node(2)
  • Muscle(2)
genes like me logo Genes that share expression patterns with PSMB1: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PSMB1 Gene

Orthologs for PSMB1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PSMB1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PSMB1 33 34
  • 99.59 (n)
oppossum
(Monodelphis domestica)
Mammalia PSMB1 34
  • 89 (a)
OneToOne
cow
(Bos Taurus)
Mammalia PSMB1 33 34
  • 88.93 (n)
dog
(Canis familiaris)
Mammalia PSMB1 33 34
  • 88.52 (n)
rat
(Rattus norvegicus)
Mammalia Psmb1 33
  • 85.57 (n)
mouse
(Mus musculus)
Mammalia Psmb1 33 16 34
  • 85.29 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PSMB1 34
  • 55 (a)
OneToOne
chicken
(Gallus gallus)
Aves PSMB1 33 34
  • 79.01 (n)
lizard
(Anolis carolinensis)
Reptilia PSMB1 34
  • 81 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia psmb1 33
  • 75.23 (n)
MGC75736 33
African clawed frog
(Xenopus laevis)
Amphibia psmb1-prov 33
zebrafish
(Danio rerio)
Actinopterygii psmb1 33 34
  • 71.7 (n)
wufc51f06 33
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8243 33
fruit fly
(Drosophila melanogaster)
Insecta Pros26 35 33 34
  • 57.7 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP004991 33
  • 57.56 (n)
worm
(Caenorhabditis elegans)
Secernentea pbs-6 33 34
  • 50.25 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_AGL324W 33
  • 54.98 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PRE7 33 34 36
  • 54.46 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0E05633g 33
  • 54.07 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons PBF1 33
  • 54.09 (n)
rice
(Oryza sativa)
Liliopsida Os09g0505600 33
  • 53.91 (n)
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes pam1 33
  • 52.25 (n)
bread mold
(Neurospora crassa)
Ascomycetes NCU09366 33
  • 52.01 (n)
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.4908 33
Species where no ortholog for PSMB1 was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PSMB1 Gene

ENSEMBL:
Gene Tree for PSMB1 (if available)
TreeFam:
Gene Tree for PSMB1 (if available)

Paralogs for PSMB1 Gene

Pseudogenes.org Pseudogenes for PSMB1 Gene

genes like me logo Genes that share paralogs with PSMB1: view

No data available for Paralogs for PSMB1 Gene

Variants for PSMB1 Gene

Sequence variations from dbSNP and Humsavar for PSMB1 Gene

SNP ID Clin Chr 06 pos Sequence Context AA Info Type
rs1000038708 -- 170,543,104(+) ATTAA(C/G)TAACA intron-variant
rs1000048686 -- 170,536,478(+) CACAA(A/G)AAAAA intron-variant
rs1000326799 -- 170,546,404(+) AATGG(A/G)CTAAA intron-variant
rs1000619544 -- 170,552,925(+) CCAAG(A/T)AAACT intron-variant, upstream-variant-2KB
rs1000649814 -- 170,534,827(+) CTCTC(C/T)CTTCT downstream-variant-500B

Structural Variations from Database of Genomic Variants (DGV) for PSMB1 Gene

Variant ID Type Subtype PubMed ID
esv2759497 CNV gain+loss 17122850
nsv1015584 CNV gain 25217958
nsv1033491 CNV loss 25217958
nsv428158 CNV gain 18775914
nsv830874 CNV loss 17160897

Variation tolerance for PSMB1 Gene

Residual Variation Intolerance Score: 32.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 7.82; 83.48% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PSMB1 Gene

Human Gene Mutation Database (HGMD)
PSMB1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PSMB1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PSMB1 Gene

Disorders for PSMB1 Gene

MalaCards: The human disease database

(2) MalaCards diseases for PSMB1 Gene - From: HGMD, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
diabetes mellitus, insulin-dependent, 8
  • type 1 diabetes mellitus 8
cystic fibrosis
  • pseudomonas aeruginosa chronic infection by, in cystic fibrosis
- elite association - COSMIC cancer census association via MalaCards
Search PSMB1 in MalaCards View complete list of genes associated with diseases

Relevant External Links for PSMB1

Genetic Association Database (GAD)
PSMB1
Human Genome Epidemiology (HuGE) Navigator
PSMB1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PSMB1
genes like me logo Genes that share disorders with PSMB1: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PSMB1 Gene

Publications for PSMB1 Gene

  1. Molecular cloning and sequence analysis of cDNAs for five major subunits of human proteasomes (multi-catalytic proteinase complexes). (PMID: 2025653) Tamura T … Ichihara A (Biochimica et biophysica acta 1991) 2 3 4 60
  2. Mass spectrometric characterization of the affinity-purified human 26S proteasome complex. (PMID: 17323924) Wang X … Huang L (Biochemistry 2007) 3 4 60
  3. Evaluation of IDDM8 susceptibility locus in a Russian simplex family data set. (PMID: 15848047) Chistiakov DA … Nosikov VV (Journal of autoimmunity 2005) 3 45 60
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 60
  5. Interaction of plasminogen activator inhibitor-2 and proteasome subunit, beta type 1. (PMID: 14732874) Fan J … Zhu YS (Acta biochimica et biophysica Sinica 2004) 3 4 60

Products for PSMB1 Gene

Sources for PSMB1 Gene