Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PRSS23 Gene

Aliases for PRSS23 Gene

  • Protease, Serine 23 2 3 5
  • Putative Secreted Protein Zsig13 3 4
  • ZSIG13 3 4
  • Serine Protease, Umbilical Endothelium 3
  • Serine Protease 23 3
  • EC 3.4.21.4 61
  • EC 3.4.21.- 4
  • EC 3.4.21 61
  • SIG13 3
  • SPUVE 3

External Ids for PRSS23 Gene

Previous GeneCards Identifiers for PRSS23 Gene

  • GC11P086189
  • GC11P086511

Summaries for PRSS23 Gene

Entrez Gene Summary for PRSS23 Gene

  • This gene encodes a conserved member of the trypsin family of serine proteases. Mouse studies found a decrease of mRNA levels of this gene after ovulation was induced. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

GeneCards Summary for PRSS23 Gene

PRSS23 (Protease, Serine 23) is a Protein Coding gene. GO annotations related to this gene include serine-type endopeptidase activity. An important paralog of this gene is PRSS35.

Gene Wiki entry for PRSS23 Gene

No data available for CIViC summary , UniProtKB/Swiss-Prot , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PRSS23 Gene

Genomics for PRSS23 Gene

Regulatory Elements for PRSS23 Gene

Enhancers for PRSS23 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH11G086734 2 FANTOM5 Ensembl ENCODE dbSUPER 19 -49.1 -49050 14.2 HDGF PKNOX1 FOXA2 ARNT SIN3A FEZF1 ZNF766 CBX5 ZNF143 FOS PRSS23 ME3 LOC102724775
GH11G086576 1.5 Ensembl ENCODE dbSUPER 16.4 -213.2 -213167 3.6 PKNOX1 FEZF1 CBX5 GATA2 FOS ZNF263 JUNB TSHZ1 ZNF488 TBX21 PRSS23 ME3 PIR51426 PIR57473 GC11P086542
GH11G086171 1.9 FANTOM5 Ensembl ENCODE dbSUPER 11.7 -615.0 -614958 9.4 HDGF PKNOX1 FOXA2 CREB3L1 ARNT SIN3A ZNF2 ZNF766 FOS JUNB PICALM RNU6-560P PRSS23 EED CREBZF ENSG00000254699
GH11G086156 1.9 FANTOM5 Ensembl ENCODE dbSUPER 11.7 -630.7 -630656 8.4 HDGF PKNOX1 FOXA2 ARNT YY1 ZNF766 FOS SP5 ZNF592 KAT8 PICALM PRSS23 HIKESHI RNU6-560P ENSG00000254699
GH11G086522 1.6 Ensembl ENCODE dbSUPER 9.9 -266.8 -266767 3.0 HDGF FOXA2 ARNT FEZF1 YBX1 YY1 ZNF207 FOS DEK SP3 PRSS23 CCDC81 PIR41176 PIR44417
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PRSS23 on UCSC Golden Path with GeneCards custom track

Genomic Location for PRSS23 Gene

Chromosome:
11
Start:
86,791,059 bp from pter
End:
86,952,910 bp from pter
Size:
161,852 bases
Orientation:
Plus strand

Genomic View for PRSS23 Gene

Genes around PRSS23 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PRSS23 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PRSS23 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PRSS23 Gene

Proteins for PRSS23 Gene

  • Protein details for PRSS23 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O95084-PRS23_HUMAN
    Recommended name:
    Serine protease 23
    Protein Accession:
    O95084
    Secondary Accessions:
    • B2RDJ1
    • B4E2J3
    • Q6IBI0

    Protein attributes for PRSS23 Gene

    Size:
    383 amino acids
    Molecular mass:
    43001 Da
    Quaternary structure:
    No Data Available

    Alternative splice isoforms for PRSS23 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PRSS23 Gene

Selected DME Specific Peptides for PRSS23 Gene

O95084:
  • RFSIFGKDFLLNYPFSTSVKLSTGCTGTLVAEKHVLTAA
  • VLTAAHC
  • NGSPQDFNVAVRITPLKYAQICYWIKGNY
  • AKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGS
  • DYDYALLEL
  • SRRKRQIYGYD
  • SGSGVYV

Post-translational modifications for PRSS23 Gene

  • Ubiquitination at isoforms=50
  • Glycosylation at isoforms=73, Asn93, and Asn207
  • Modification sites at PhosphoSitePlus

Other Protein References for PRSS23 Gene

Domains & Families for PRSS23 Gene

Gene Families for PRSS23 Gene

Suggested Antigen Peptide Sequences for PRSS23 Gene

Graphical View of Domain Structure for InterPro Entry

O95084

UniProtKB/Swiss-Prot:

PRS23_HUMAN :
  • Belongs to the peptidase S1 family.
Family:
  • Belongs to the peptidase S1 family.
genes like me logo Genes that share domains with PRSS23: view

Function for PRSS23 Gene

Enzyme Numbers (IUBMB) for PRSS23 Gene

Gene Ontology (GO) - Molecular Function for PRSS23 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004252 serine-type endopeptidase activity IEA --
GO:0008233 peptidase activity IEA --
GO:0008236 serine-type peptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with PRSS23: view
genes like me logo Genes that share phenotypes with PRSS23: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PRSS23

Inhibitory RNA Products

Clone Products

No data available for Molecular function , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PRSS23 Gene

Localization for PRSS23 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PRSS23 Gene

Secreted.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PRSS23 gene
Compartment Confidence
extracellular 5
nucleus 5

Gene Ontology (GO) - Cellular Components for PRSS23 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region IEA --
GO:0005615 extracellular space IEA --
GO:0005634 nucleus IDA --
GO:0005788 endoplasmic reticulum lumen TAS --
GO:0070062 extracellular exosome IDA 19199708
genes like me logo Genes that share ontologies with PRSS23: view

Pathways & Interactions for PRSS23 Gene

SuperPathways for PRSS23 Gene

No Data Available

Gene Ontology (GO) - Biological Process for PRSS23 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IEA --
GO:0043687 post-translational protein modification TAS --
GO:0044267 cellular protein metabolic process TAS --
genes like me logo Genes that share ontologies with PRSS23: view

No data available for Pathways by source and SIGNOR curated interactions for PRSS23 Gene

Drugs & Compounds for PRSS23 Gene

No Compound Related Data Available

Transcripts for PRSS23 Gene

Unigene Clusters for PRSS23 Gene

Protease, serine, 23:
Representative Sequences:

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for PRSS23 Gene

ExUns: 1a · 1b ^ 2a · 2b
SP1:
SP2:

Relevant External Links for PRSS23 Gene

GeneLoc Exon Structure for
PRSS23
ECgene alternative splicing isoforms for
PRSS23

Expression for PRSS23 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PRSS23 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for PRSS23 Gene

This gene is overexpressed in Bone marrow mesenchymal stem cell (47.7) and Amniocyte (17.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PRSS23 Gene



NURSA nuclear receptor signaling pathways regulating expression of PRSS23 Gene:

PRSS23

SOURCE GeneReport for Unigene cluster for PRSS23 Gene:

Hs.25338

Evidence on tissue expression from TISSUES for PRSS23 Gene

  • Nervous system(3.9)
  • Lung(3.2)
  • Pancreas(2.6)
  • Intestine(2.5)
genes like me logo Genes that share expression patterns with PRSS23: view

Primer Products

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for PRSS23 Gene

Orthologs for PRSS23 Gene

This gene was present in the common ancestor of chordates.

Orthologs for PRSS23 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PRSS23 34 35
  • 99.56 (n)
dog
(Canis familiaris)
Mammalia PRSS23 34 35
  • 88.54 (n)
cow
(Bos Taurus)
Mammalia PRSS23 34 35
  • 87.73 (n)
mouse
(Mus musculus)
Mammalia Prss23 34 16 35
  • 86.21 (n)
oppossum
(Monodelphis domestica)
Mammalia PRSS23 35
  • 86 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Prss23 34
  • 85.47 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PRSS23 35
  • 82 (a)
OneToOne
chicken
(Gallus gallus)
Aves PRSS23 34 35
  • 78.21 (n)
lizard
(Anolis carolinensis)
Reptilia PRSS23 35
  • 79 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia prss23 34
  • 70.9 (n)
zebrafish
(Danio rerio)
Actinopterygii PRSS23 35
  • 49 (a)
OneToOne
wufb01h12 34
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.8589 34
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 37 (a)
OneToMany
Species where no ortholog for PRSS23 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for PRSS23 Gene

ENSEMBL:
Gene Tree for PRSS23 (if available)
TreeFam:
Gene Tree for PRSS23 (if available)

Paralogs for PRSS23 Gene

Paralogs for PRSS23 Gene

(1) SIMAP similar genes for PRSS23 Gene using alignment to 5 proteins:

genes like me logo Genes that share paralogs with PRSS23: view

Variants for PRSS23 Gene

Sequence variations from dbSNP and Humsavar for PRSS23 Gene

SNP ID Clin Chr 11 pos Sequence Context AA Info Type
rs104894223 Pathogenic 86,951,990(-) CCATC(A/G)TATTT nc-transcript-variant, reference, missense
rs80358284 Pathogenic 86,952,443(-) TGCCA(A/G/T)TGTGC nc-transcript-variant, reference, missense
rs80358292 Pathogenic 86,951,751(-) AAATG(C/G)GGTCA nc-transcript-variant, reference, missense
rs80358293 Pathogenic 86,951,732(-) TTGAA(A/G)TGCAC nc-transcript-variant, reference, missense
rs80358294 Pathogenic 86,951,506(-) AATTC(A/C/G)GTCAA nc-transcript-variant, reference, missense

Structural Variations from Database of Genomic Variants (DGV) for PRSS23 Gene

Variant ID Type Subtype PubMed ID
esv2658766 CNV deletion 23128226
esv2666085 CNV deletion 23128226
esv27019 CNV loss 19812545
esv2744857 CNV deletion 23290073
esv2744858 CNV deletion 23290073
esv2760199 CNV loss 21179565
esv3334201 CNV insertion 20981092
esv3548100 CNV deletion 23714750
esv3579789 CNV loss 25503493
esv3627099 CNV gain 21293372
esv3627105 CNV loss 21293372
esv3627106 CNV loss 21293372
esv3627107 CNV loss 21293372
esv3627108 CNV loss 21293372
esv3627109 CNV loss 21293372
esv3627110 CNV loss 21293372
esv988093 CNV gain 20482838
nsv1049157 CNV gain 25217958
nsv1076378 CNV duplication 25765185
nsv1143549 CNV deletion 24896259
nsv1144582 CNV deletion 24896259
nsv428263 CNV loss 18775914
nsv521505 CNV gain 19592680
nsv523704 CNV loss 19592680
nsv524804 CNV loss 19592680
nsv975959 CNV duplication 23825009

Variation tolerance for PRSS23 Gene

Residual Variation Intolerance Score: 37% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.41; 27.67% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PRSS23 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PRSS23

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PRSS23 Gene

Disorders for PRSS23 Gene

Relevant External Links for PRSS23

Genetic Association Database (GAD)
PRSS23
Human Genome Epidemiology (HuGE) Navigator
PRSS23
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PRSS23

No disorders were found for PRSS23 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PRSS23 Gene

Publications for PRSS23 Gene

  1. Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes. (PMID: 20532202) Naukkarinen J. … Peltonen L. (PLoS Genet. 2010) 3 46 64
  2. The identification of novel ovarian proteases through the use of genomic and bioinformatic methodologies. (PMID: 16870946) Miyakoshi K. … Hennebold J.D. (Biol. Reprod. 2006) 3 22 64
  3. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
  4. The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. (PMID: 12975309) Clark H.F. … Gray A.M. (Genome Res. 2003) 3 4 64
  5. Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. (PMID: 11230166) Wiemann S. … Poustka A. (Genome Res. 2001) 3 4 64

Products for PRSS23 Gene

Sources for PRSS23 Gene

Content
Loading form....