Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PPIE Gene

Aliases for PPIE Gene

  • Peptidylprolyl Isomerase E 2 3 5
  • Rotamase E 2 3 4
  • PPIase E 2 3 4
  • Peptidyl-Prolyl Cis-Trans Isomerase E 2 3
  • Cyclophilin-33 3 4
  • Cyclophilin E 2 4
  • EC 5.2.1.8 4 58
  • CYP33 3 4
  • Peptidylprolyl Isomerase E (Cyclophilin E) 3
  • Peptidylprolyl Isomerase E, Isoform 1 2
  • Cyclophilin 33 2
  • CYP-33 3

External Ids for PPIE Gene

Previous GeneCards Identifiers for PPIE Gene

  • GC01P040234
  • GC01P039208
  • GC01P039668
  • GC01P039618
  • GC01P039619
  • GC01P039873
  • GC01P039977
  • GC01P040157
  • GC01P038323

Summaries for PPIE Gene

Entrez Gene Summary for PPIE Gene

  • The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities, and it also exhibits RNA-binding activity. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 1, has been identified. [provided by RefSeq, Aug 2010]

GeneCards Summary for PPIE Gene

PPIE (Peptidylprolyl Isomerase E) is a Protein Coding gene. Among its related pathways are Transcription-Coupled Nucleotide Excision Repair (TC-NER) and mRNA Splicing - Major Pathway. GO annotations related to this gene include nucleic acid binding and RNA binding. An important paralog of this gene is RANBP2.

UniProtKB/Swiss-Prot for PPIE Gene

  • PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing.

Gene Wiki entry for PPIE Gene

Additional gene information for PPIE Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PPIE Gene

Genomics for PPIE Gene

Regulatory Elements for PPIE Gene

Enhancers for PPIE Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01H040256 1.2 ENCODE 127.5 +565.5 565527 2 ZFP64 FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF548 SP3 ZC3H11A ZFP41 PPIE PPIEL EXO5 TRIT1 ENSG00000259943 RLF NFYC-AS1 LOC105378672 ENSG00000182109 COL9A2
GH01H040372 1.8 FANTOM5 ENCODE dbSUPER 63.9 +683.7 683671 5 HDGF PKNOX1 ARNT ARID4B SIN3A FEZF1 ZNF2 YY1 SLC30A9 ZNF766 PPIEL PPIE TRIT1 EXO5 SMAP2 ENSG00000259943 ENSG00000182109 RLF NFYC-AS1 LOC105378674
GH01H038984 1.5 Ensembl ENCODE dbSUPER 65.6 -706.0 -705964 2 PKNOX1 FOXA2 ZFP64 YY1 ZNF121 FOS TSHZ1 REST ZNF623 ZNF518A PPIE PPIEL TRIT1 SF3A3 NDUFS5 MYCBP RRAGC ENSG00000182109 LOC101929516 AKIRIN1
GH01H039738 1 ENCODE 84.9 +46.8 46831 1 ATF1 SIN3A ZNF2 YY1 ETS1 GLIS2 ELK1 ATF7 RUNX3 SP3 PPIE BMP8B OXCT2 TRIT1 ENSG00000202222 PIR58872 RNU7-121P
GH01H039025 1.1 ENCODE 48.5 -665.6 -665617 2 HDGF PKNOX1 ARID4B SIN3A DMAP1 YBX1 ZNF2 YY1 SLC30A9 SP3 NDUFS5 PPIE MYCBP LOC101929516 TRIT1 AKIRIN1 SNORA55 GJA9 RRAGC LOC105378663
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PPIE on UCSC Golden Path with GeneCards custom track

Genomic Location for PPIE Gene

Chromosome:
1
Start:
39,692,182 bp from pter
End:
39,763,914 bp from pter
Size:
71,733 bases
Orientation:
Plus strand

Genomic View for PPIE Gene

Genes around PPIE on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PPIE Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PPIE Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PPIE Gene

Proteins for PPIE Gene

  • Protein details for PPIE Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UNP9-PPIE_HUMAN
    Recommended name:
    Peptidyl-prolyl cis-trans isomerase E
    Protein Accession:
    Q9UNP9
    Secondary Accessions:
    • B2R971
    • O43634
    • O43635
    • Q32Q72
    • Q3S611
    • Q5TGA0
    • Q5TGA2
    • Q5TGA3
    • Q9UIZ5

    Protein attributes for PPIE Gene

    Size:
    301 amino acids
    Molecular mass:
    33431 Da
    Quaternary structure:
    • Identified in the spliceosome C complex. Component of the XAB2 complex, a multimeric protein complex composed of XAB2, PRPF19, AQR, ZNF830, ISY1, and PPIE.

    Three dimensional structures from OCA and Proteopedia for PPIE Gene

    Alternative splice isoforms for PPIE Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PPIE Gene

Selected DME Specific Peptides for PPIE Gene

Q9UNP9:
  • GLLSMAN
  • FMCQGGDF
  • TEKHRGFAFVEFE
  • TNGSQFF
  • AIDNMNESE
  • KKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFR
  • GDFTNHNGTGG
  • GPNTNGSQ
  • GGKSIYG
  • LDGKHVVFG
  • LLSMANSGP
  • HVVFGEV

Post-translational modifications for PPIE Gene

  • Ubiquitination at posLast=218218
  • Modification sites at PhosphoSitePlus

Domains & Families for PPIE Gene

Gene Families for PPIE Gene

Graphical View of Domain Structure for InterPro Entry

Q9UNP9

UniProtKB/Swiss-Prot:

PPIE_HUMAN :
  • Belongs to the cyclophilin-type PPIase family. PPIase E subfamily.
Family:
  • Belongs to the cyclophilin-type PPIase family. PPIase E subfamily.
genes like me logo Genes that share domains with PPIE: view

Function for PPIE Gene

Molecular function for PPIE Gene

GENATLAS Biochemistry:
cyclophilin E,FKB (FK506 binding protein)-type peptidyl-prolyl cis-trans-isomerase,highly expressed in muscle and brain,coamplified with MYCL1 in small cell lung cancer lines
UniProtKB/Swiss-Prot CatalyticActivity:
Peptidylproline (omega=180) = peptidylproline (omega=0).
UniProtKB/Swiss-Prot Function:
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing.

Enzyme Numbers (IUBMB) for PPIE Gene

Phenotypes From GWAS Catalog for PPIE Gene

Gene Ontology (GO) - Molecular Function for PPIE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003676 nucleic acid binding IEA --
GO:0003723 RNA binding TAS 11313484
GO:0003755 peptidyl-prolyl cis-trans isomerase activity TAS 11313484
GO:0005515 protein binding IPI 11313484
GO:0016018 cyclosporin A binding TAS 9747881
genes like me logo Genes that share ontologies with PPIE: view
genes like me logo Genes that share phenotypes with PPIE: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PPIE

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for PPIE
  • Applied Biological Materials Clones for PPIE
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PPIE Gene

Localization for PPIE Gene

Subcellular locations from UniProtKB/Swiss-Prot for PPIE Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PPIE gene
Compartment Confidence
nucleus 5
cytosol 5
extracellular 4

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nuclear speckles (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PPIE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region TAS --
GO:0005634 nucleus IDA,IEA 11313484
GO:0005654 nucleoplasm TAS --
GO:0005681 spliceosomal complex IEA --
GO:0005829 cytosol IDA --
genes like me logo Genes that share ontologies with PPIE: view

Pathways & Interactions for PPIE Gene

genes like me logo Genes that share pathways with PPIE: view

Pathways by source for PPIE Gene

Gene Ontology (GO) - Biological Process for PPIE Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000398 mRNA splicing, via spliceosome TAS --
GO:0000413 protein peptidyl-prolyl isomerization IEA --
GO:0006283 transcription-coupled nucleotide-excision repair TAS --
GO:0006355 regulation of transcription, DNA-templated IMP 11313484
GO:0006397 mRNA processing IEA --
genes like me logo Genes that share ontologies with PPIE: view

No data available for SIGNOR curated interactions for PPIE Gene

Drugs & Compounds for PPIE Gene

No Compound Related Data Available

Transcripts for PPIE Gene

Unigene Clusters for PPIE Gene

Peptidylprolyl isomerase E (cyclophilin E):
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for PPIE
  • Applied Biological Materials Clones for PPIE
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for PPIE Gene

ExUns: 1a · 1b · 1c · 1d · 1e ^ 2 ^ 3a · 3b ^ 4a · 4b ^ 5a · 5b · 5c · 5d ^ 6 ^ 7 ^ 8a · 8b · 8c · 8d ^ 9a · 9b · 9c ^ 10a · 10b ^ 11a ·
SP1: - - - - - - - - -
SP2: - - - - - - - - - -
SP3: - - - - - - - - - -
SP4: - - - - - - - - - - - - -
SP5: - - - - -
SP6: - - - -
SP7: - - -
SP8: - - - - - - - - - - - -
SP9: - - - -
SP10: - - - -
SP11: - - - -
SP12: - - -
SP13:
SP14: - - -
SP15: - - -

ExUns: 11b ^ 12a · 12b
SP1: -
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:
SP10: -
SP11:
SP12:
SP13:
SP14:
SP15:

Relevant External Links for PPIE Gene

GeneLoc Exon Structure for
PPIE
ECgene alternative splicing isoforms for
PPIE

Expression for PPIE Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PPIE Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for PPIE Gene

This gene is overexpressed in Liver (19.9), Heart (10.1), Peripheral blood mononuclear cells (8.7), and Spleen (6.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PPIE Gene



Protein tissue co-expression partners for PPIE Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PPIE Gene:

PPIE

SOURCE GeneReport for Unigene cluster for PPIE Gene:

Hs.524690

mRNA Expression by UniProt/SwissProt for PPIE Gene:

Q9UNP9-PPIE_HUMAN
Tissue specificity: Found in all the examined tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.

Evidence on tissue expression from TISSUES for PPIE Gene

  • Lung(4.6)
  • Nervous system(4.6)
  • Intestine(4.4)
  • Bone marrow(4.2)
  • Liver(4.2)
  • Pancreas(2.4)
  • Skin(2)
genes like me logo Genes that share expression patterns with PPIE: view

Primer Products

No data available for mRNA differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for PPIE Gene

Orthologs for PPIE Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PPIE Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PPIE 33 34
  • 99.78 (n)
dog
(Canis familiaris)
Mammalia PPIE 33 34
  • 92.47 (n)
cow
(Bos Taurus)
Mammalia PPIE 33 34
  • 91.81 (n)
mouse
(Mus musculus)
Mammalia Ppie 33 16 34
  • 90.92 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PPIE 34
  • 90 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia PPIE 34
  • 89 (a)
OneToOne
chicken
(Gallus gallus)
Aves PPIE 33 34
  • 81.73 (n)
lizard
(Anolis carolinensis)
Reptilia PPIE 34
  • 86 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ppie 33
  • 77.74 (n)
Str.10680 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.2732 33
zebrafish
(Danio rerio)
Actinopterygii ppie 33 34
  • 76.3 (n)
-- 33
fruit fly
(Drosophila melanogaster)
Insecta Cyp1 35
  • 71 (a)
CG7768 35
  • 69 (a)
cyp33 35 33 34
  • 64.64 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP009810 33
  • 65.11 (n)
worm
(Caenorhabditis elegans)
Secernentea cyp-3 35
  • 65 (a)
cyp-7 35
  • 64 (a)
cyp-13 35
  • 60 (a)
cyn-2 34
  • 60 (a)
ManyToMany
cyn-7 34
  • 60 (a)
ManyToMany
cyn-3 34
  • 59 (a)
ManyToMany
cyn-13 33
  • 58.95 (n)
cyn-1 34
  • 56 (a)
ManyToMany
cyp-8 35
  • 52 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes CPR1 34
  • 57 (a)
ManyToMany
CPR3 34
  • 51 (a)
ManyToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons AT3G55920 33
  • 62.05 (n)
rice
(Oryza sativa)
Liliopsida Os.5492 33
sea squirt
(Ciona savignyi)
Ascidiacea CSA.2828 34
  • 61 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.5879 33
Species where no ortholog for PPIE was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rat (Rattus norvegicus)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PPIE Gene

ENSEMBL:
Gene Tree for PPIE (if available)
TreeFam:
Gene Tree for PPIE (if available)

Paralogs for PPIE Gene

Variants for PPIE Gene

Sequence variations from dbSNP and Humsavar for PPIE Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs1000293842 -- 39,737,122(+) GAGCC(A/C)CTATC upstream-variant-2KB
rs1000304217 -- 39,737,550(+) CCAAG(A/T)TGTTA upstream-variant-2KB
rs1000306617 -- 39,743,582(+) ATCAA(C/G)GGCTG intron-variant
rs1000653032 -- 39,754,328(+) TTAAG(G/T)AACTG intron-variant, nc-transcript-variant, utr-variant-3-prime
rs1000667020 -- 39,736,942(+) CCTGT(A/G)CTCCC upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for PPIE Gene

Variant ID Type Subtype PubMed ID
dgv152n100 CNV gain 25217958
dgv153n100 CNV gain 25217958
dgv15n27 CNV gain 19166990
esv2758933 CNV loss 17122850
nsv1116447 OTHER inversion 24896259
nsv546062 CNV gain 21841781
nsv546063 CNV gain 21841781
nsv7177 OTHER inversion 18451855
nsv945894 CNV duplication 23825009
nsv950654 CNV deletion 24416366

Variation tolerance for PPIE Gene

Residual Variation Intolerance Score: 55.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.84; 17.59% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PPIE Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PPIE

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PPIE Gene

Disorders for PPIE Gene

Relevant External Links for PPIE

Genetic Association Database (GAD)
PPIE
Human Genome Epidemiology (HuGE) Navigator
PPIE
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PPIE

No disorders were found for PPIE Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PPIE Gene

Publications for PPIE Gene

  1. Co-amplification of a novel cyclophilin-like gene (PPIE) with L-myc in small cell lung cancer cell lines. (PMID: 9747881) Kim JO … Kelley MJ (Oncogene 1998) 2 3 4 22 60
  2. Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes. (PMID: 20532202) Naukkarinen J … ENGAGE Consortium (PLoS genetics 2010) 3 45 60
  3. The DNA sequence and biological annotation of human chromosome 1. (PMID: 16710414) Gregory SG … Prigmore E (Nature 2006) 3 4 60
  4. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 60
  5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard DS … MGC Project Team (Genome research 2004) 3 4 60

Products for PPIE Gene

  • Addgene plasmids for PPIE

Sources for PPIE Gene

Content
Loading form....