Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PLD3 Gene

Aliases for PLD3 Gene

  • Phospholipase D Family Member 3 2 3 5
  • Phosphatidylcholine-Hydrolyzing Phospholipase D3 3 4
  • Choline Phosphatase 3 3 4
  • HindIII K4L Homolog 3 4
  • Phospholipase D3 2 3
  • EC 3.1.4.4 4 61
  • HU-K4 3 4
  • Phospholipase D Family, Member 3 2
  • EC 3.1.4 61
  • PLD 3 4
  • AD19 3
  • HUK4 3

External Ids for PLD3 Gene

Previous GeneCards Identifiers for PLD3 Gene

  • GC19P041505
  • GC19P041257
  • GC19P045530
  • GC19P045546
  • GC19P045557
  • GC19P040854
  • GC19P037290

Summaries for PLD3 Gene

Entrez Gene Summary for PLD3 Gene

  • This gene encodes a member of the phospholipase D (PLD) family of enzymes that catalyze the hydrolysis of membrane phospholipids. The encoded protein is a single-pass type II membrane protein and contains two PLD phosphodiesterase domains. This protein influences processing of amyloid-beta precursor protein. Mutations in this gene are associated with Alzheimer disease risk. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Apr 2014]

GeneCards Summary for PLD3 Gene

PLD3 (Phospholipase D Family Member 3) is a Protein Coding gene. Diseases associated with PLD3 include Alzheimer Disease 19, Late Onset and Acute Conjunctivitis. Among its related pathways are Metabolism and Immune System. GO annotations related to this gene include phospholipase D activity and N-acylphosphatidylethanolamine-specific phospholipase D activity. An important paralog of this gene is PLD4.

UniProtKB/Swiss-Prot for PLD3 Gene

  • May be involved in APP processing.

No data available for Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PLD3 Gene

Genomics for PLD3 Gene

Regulatory Elements for PLD3 Gene

Enhancers for PLD3 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH19F040347 1.2 ENCODE 13.9 +0.2 160 2.2 HDGF PKNOX1 CREB3L1 MLX ZFP64 ARID4B SIN3A FEZF1 DMAP1 ZNF2 SNRPA ENSG00000269843 FBL ENSG00000205041 ENSG00000269069 CCDC97 RN7SL566P COQ8B ITPKC RPS16
GH19F040219 1.6 FANTOM5 Ensembl ENCODE 9.9 -128.4 -128354 1.5 ZNF2 GLIS2 FOS ZNF263 SP3 YY2 REST ZNF518A SMARCA4 GLIS1 ENSG00000269843 SNRPA FBL ITPKC RPS16 LGALS14 ENSG00000271299 ENSG00000269792 LOC105372399 ENSG00000269188
GH19F040340 1.2 FANTOM5 Ensembl ENCODE 12.5 -6.2 -6221 3.3 CTCF FEZF1 ZEB2 RAD21 ZEB1 ZNF121 JUND ZNF366 GLIS1 ZNF747 PLD3 ENSG00000269843 SNRPA PSMC4 C19orf47 SERTAD3 ENSG00000207281 GC19P040343
GH19F040273 1.3 Ensembl ENCODE 11.2 -73.7 -73742 3.0 HDGF ATF1 ARNT CREB3L1 WRNIP1 ZFP64 YBX1 ZNF121 GLIS2 ZNF302 SNRPA ENSG00000269843 FBL MAP3K10 ITPKC RPS16 EID2B SERTAD3 ENSG00000205041 CYP2F2P
GH19F040190 1.4 FANTOM5 ENCODE 10.1 -157.2 -157198 2.3 HDGF PKNOX1 CREB3L1 ARID4B SIN3A DMAP1 ZNF2 ZNF207 ZNF143 KLF13 TTC9B CNTD2 RPS16 ZNF546 ENSG00000269069 HIPK4 EID2B PLD3 C19orf47 ENSG00000206925
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PLD3 on UCSC Golden Path with GeneCards custom track

Promoters for PLD3 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000346584 75 2600 HDGF PKNOX1 CREB3L1 MLX ZFP64 ARID4B SIN3A FEZF1 DMAP1 ZNF2

Genomic Location for PLD3 Gene

Chromosome:
19
Start:
40,348,425 bp from pter
End:
40,380,439 bp from pter
Size:
32,015 bases
Orientation:
Plus strand

Genomic View for PLD3 Gene

Genes around PLD3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PLD3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PLD3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PLD3 Gene

Proteins for PLD3 Gene

  • Protein details for PLD3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8IV08-PLD3_HUMAN
    Recommended name:
    Phospholipase D3
    Protein Accession:
    Q8IV08
    Secondary Accessions:
    • Q92853
    • Q9BW87

    Protein attributes for PLD3 Gene

    Size:
    490 amino acids
    Molecular mass:
    54705 Da
    Quaternary structure:
    • Interacts with APP.
    SequenceCaution:
    • Sequence=AAB16799.1; Type=Frameshift; Positions=52; Evidence={ECO:0000305};

neXtProt entry for PLD3 Gene

Selected DME Specific Peptides for PLD3 Gene

Q8IV08:
  • DTRYNQETPMEICLNGTPALAYLASAPPPLCP
  • YNCSCLA
  • DNHTHSDIQVKLFVVP
  • DIASFYW
  • YIGTSNWSG
  • LHTKFWVVD
  • VRLLISCW
  • KIFEAYW
  • GRTPDLKALL
  • IPYARVNHNKYMVT
  • GSANMDW
  • LARDLTK
  • SAQQGEEVLRQLQTLAP
  • ELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFL
  • LVESIPE

Post-translational modifications for PLD3 Gene

Domains & Families for PLD3 Gene

Gene Families for PLD3 Gene

Protein Domains for PLD3 Gene

Graphical View of Domain Structure for InterPro Entry

Q8IV08

UniProtKB/Swiss-Prot:

PLD3_HUMAN :
  • Contains 2 PLD phosphodiesterase domains.
  • Belongs to the phospholipase D family.
Domain:
  • Contains 2 PLD phosphodiesterase domains.
Family:
  • Belongs to the phospholipase D family.
genes like me logo Genes that share domains with PLD3: view

Function for PLD3 Gene

Molecular function for PLD3 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
A phosphatidylcholine + H(2)O = choline + a phosphatidate.
UniProtKB/Swiss-Prot Function:
May be involved in APP processing.

Enzyme Numbers (IUBMB) for PLD3 Gene

Gene Ontology (GO) - Molecular Function for PLD3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004630 phospholipase D activity IEA,TAS --
GO:0005515 protein binding IPI 20195357
GO:0016787 hydrolase activity IEA --
GO:0070290 N-acylphosphatidylethanolamine-specific phospholipase D activity IEA --
genes like me logo Genes that share ontologies with PLD3: view
genes like me logo Genes that share phenotypes with PLD3: view

Animal Models for PLD3 Gene

MGI Knock Outs for PLD3:
  • Pld3 tm1e(EUCOMM)Wtsi

Animal Model Products

miRNA for PLD3 Gene

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PLD3 Gene

Localization for PLD3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PLD3 Gene

Endoplasmic reticulum membrane; Single-pass type II membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PLD3 gene
Compartment Confidence
extracellular 5
endoplasmic reticulum 4
plasma membrane 3
nucleus 2
cytosol 2

Gene Ontology (GO) - Cellular Components for PLD3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IEA --
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
GO:0070062 extracellular exosome IDA 19056867
genes like me logo Genes that share ontologies with PLD3: view

Pathways & Interactions for PLD3 Gene

genes like me logo Genes that share pathways with PLD3: view

Gene Ontology (GO) - Biological Process for PLD3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0016042 lipid catabolic process IEA --
genes like me logo Genes that share ontologies with PLD3: view

No data available for SIGNOR curated interactions for PLD3 Gene

Drugs & Compounds for PLD3 Gene

(3) Drugs for PLD3 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
Choline Approved Nutra 148
Ethanolamine Experimental Pharma 0

(8) Additional Compounds for PLD3 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
PC(18:1(9Z)e/2:0)
  • (2-acetyloxy-3-octadec-9-enoxypropyl) 2-trimethylazaniumylethyl phosphate
  • 2-Acetyl-1-(9Z-octadecenyl)-sn-glycero-3-phosphocholine
  • PC(O-18:1(9Z)/2:0)
PE(P-16:0e/16:0)
  • 2-Hexadecanoyl-1-(1Z-hexadecenyl)-sn-glycero-3-phosphoethanolamine
PEP-16:0/18:1(11Z))
  • 1-(1-Enyl-palmitoyl)-2-vaccenoyl-sn-glycero-3-phosphoethanolamine
  • GPEtn(16:0/18:1)
  • GPEtn(16:0/18:1n7)
  • GPEtn(16:0/18:1w7)
  • GPEtn(34:1)
Phosphatidylcholines Group A
  • (Z,Z)-(1)-(7-Oleoyl-4-oxido-10-oxo-3,5,9-trioxa-4-phosphaheptacos-18-enyl)trimethylammonium 4-oxide
  • (Z,Z)-4-hydroxy-N,N,N-trimethyl-10-oxo-7-[(1-oxo-9-octadecenyl)oxy]-3,5,9-Trioxa-4-phosphaheptacos-18-en-1-aminium 4-oxide hydroxide inner salt
  • 1,2-Dioleoyl-rac-glycero-3-phosphocholine
  • 1,2-Dioleoylglycerol-3-phosphorylcholine
  • 1,2-Dioleoylglyceryl-3-phosphorylcholine
68737-67-7
Phosphatidylcholines Group B
  • 1-(1-Enyl-palmitoyl)-2-stearidonoyl-sn-glycero-3-phosphocholine
  • GPCho(16:0/18:4)
  • GPCho(16:0/18:4n3)
  • GPCho(16:0/18:4w3)
  • GPCho(34:4)
88542-95-4
genes like me logo Genes that share compounds with PLD3: view

Transcripts for PLD3 Gene

Unigene Clusters for PLD3 Gene

Phospholipase D family, member 3:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for PLD3 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4a · 4b · 4c · 4d · 4e ^ 5 ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9a · 9b · 9c ^ 10a · 10b ^ 11a · 11b ^ 12 ^ 13a · 13b ^
SP1: - - - - -
SP2: - - - - - - - -
SP3: - - - - - - - - - -
SP4: - - - - - - -
SP5: - - - - - - - -
SP6: - - - - - - - - -
SP7: - -
SP8: - -
SP9:
SP10: - - - -
SP11: - - -
SP12: - -
SP13: - -
SP14: - - - -
SP15:
SP16: -
SP17: - - -

ExUns: 14a · 14b ^ 15a · 15b · 15c ^ 16 ^ 17 ^ 18a · 18b · 18c
SP1: -
SP2: -
SP3:
SP4: - -
SP5:
SP6:
SP7:
SP8:
SP9: -
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:

Relevant External Links for PLD3 Gene

GeneLoc Exon Structure for
PLD3
ECgene alternative splicing isoforms for
PLD3

Expression for PLD3 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PLD3 Gene

Protein differential expression in normal tissues from HIPED for PLD3 Gene

This gene is overexpressed in Amniocyte (16.3) and Adrenal (6.8).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PLD3 Gene



Protein tissue co-expression partners for PLD3 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PLD3 Gene:

PLD3

SOURCE GeneReport for Unigene cluster for PLD3 Gene:

Hs.257008

mRNA Expression by UniProt/SwissProt for PLD3 Gene:

Q8IV08-PLD3_HUMAN
Tissue specificity: Widely expressed. In the brain, high levels of expression are detected in the frontal, temporal and occipital cortices and hippocampus. Expressed at low level in corpus callosum.
genes like me logo Genes that share expression patterns with PLD3: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for PLD3 Gene

Orthologs for PLD3 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PLD3 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PLD3 34 35
  • 99.7 (n)
dog
(Canis familiaris)
Mammalia PLD3 34 35
  • 93.61 (n)
cow
(Bos Taurus)
Mammalia PLD3 34 35
  • 91.97 (n)
rat
(Rattus norvegicus)
Mammalia Pld3 34
  • 88.32 (n)
mouse
(Mus musculus)
Mammalia Pld3 34 16 35
  • 88.18 (n)
oppossum
(Monodelphis domestica)
Mammalia PLD3 35
  • 70 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia PLD3 35
  • 54 (a)
OneToOne
chicken
(Gallus gallus)
Aves PLD3 35
  • 44 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia PLD3