Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PLD3 Gene

Aliases for PLD3 Gene

  • Phospholipase D Family Member 3 2 3 5
  • Phosphatidylcholine-Hydrolyzing Phospholipase D3 3 4
  • Choline Phosphatase 3 3 4
  • HindIII K4L Homolog 3 4
  • Phospholipase D3 2 3
  • EC 3.1.4.4 4 61
  • HU-K4 3 4
  • Phospholipase D Family, Member 3 2
  • EC 3.1.4 61
  • PLD 3 4
  • AD19 3
  • HUK4 3

External Ids for PLD3 Gene

Previous GeneCards Identifiers for PLD3 Gene

  • GC19P041505
  • GC19P041257
  • GC19P045530
  • GC19P045546
  • GC19P045557
  • GC19P040854
  • GC19P037290

Summaries for PLD3 Gene

Entrez Gene Summary for PLD3 Gene

  • This gene encodes a member of the phospholipase D (PLD) family of enzymes that catalyze the hydrolysis of membrane phospholipids. The encoded protein is a single-pass type II membrane protein and contains two PLD phosphodiesterase domains. This protein influences processing of amyloid-beta precursor protein. Mutations in this gene are associated with Alzheimer disease risk. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Apr 2014]

GeneCards Summary for PLD3 Gene

PLD3 (Phospholipase D Family Member 3) is a Protein Coding gene. Diseases associated with PLD3 include Alzheimer Disease 19, Late Onset and Conjunctival Folliculosis. Among its related pathways are GPCR Pathway and Phospholipase-C Pathway. GO annotations related to this gene include phospholipase D activity and N-acylphosphatidylethanolamine-specific phospholipase D activity. An important paralog of this gene is PLD4.

UniProtKB/Swiss-Prot for PLD3 Gene

  • May be involved in APP processing.

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PLD3 Gene

Genomics for PLD3 Gene

Regulatory Elements for PLD3 Gene

Enhancers for PLD3 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH19G040347 1.2 ENCODE 13.9 +0.2 160 2.2 MLX CREB3L1 ZFP64 FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF548 SP3 ENSG00000205041 SNRPA ENSG00000269843 ENSG00000269069 NUMBL FBL EID2B PLD3 PRX RN7SL566P
GH19G040340 1.3 FANTOM5 Ensembl ENCODE 12.5 -6.2 -6221 3.3 CTCF ZNF777 FEZF1 RAD21 ZEB1 ZNF121 ZNF366 SCRT2 SMC3 EZH2 ENSG00000205041 PLD3 ENSG00000269069 NUMBL ENSG00000269843 SNRPA EID2B PSMC4 C19orf47 SERTAD3
GH19G040219 1.6 FANTOM5 Ensembl ENCODE 9.9 -128.4 -128354 1.5 FOXA2 SIN3A ZNF2 GLIS2 GATA2 FOS ZNF263 SP3 YY2 REST ENSG00000269843 SNRPA FBL ITPKC RPS16 MAP3K10 RN7SL566P ENSG00000268366 SERTAD3 PSMC4
GH19G040441 1.4 ENCODE dbSUPER 10.9 +95.8 95824 5.4 MLX CREB3L1 AGO1 ZFP64 FEZF1 DMAP1 YY1 ZNF143 SP3 NFYC EID2B SERTAD3 ENSG00000205041 ENSG00000269069 SNRPA ENSG00000269843 ZNF546 HIPK4 FBL ITPKC
GH19G040190 1.4 FANTOM5 ENCODE 10.1 -157.2 -157198 2.3 HDGF PKNOX1 CREB3L1 AGO1 ARID4B SIN3A DMAP1 ZNF2 ZBTB7B ZNF766 ENSG00000205041 NUMBL EID2B ENSG00000269069 TTC9B CNTD2 HIPK4 ENSG00000206925 PLD3 C19orf47
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PLD3 on UCSC Golden Path with GeneCards custom track

Promoters for PLD3 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000109511 75 1801 MLX CREB3L1 ZFP64 FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF548 SP3

Genomic Location for PLD3 Gene

Chromosome:
19
Start:
40,348,425 bp from pter
End:
40,380,439 bp from pter
Size:
32,015 bases
Orientation:
Plus strand

Genomic View for PLD3 Gene

Genes around PLD3 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PLD3 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PLD3 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PLD3 Gene

Proteins for PLD3 Gene

  • Protein details for PLD3 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q8IV08-PLD3_HUMAN
    Recommended name:
    Phospholipase D3
    Protein Accession:
    Q8IV08
    Secondary Accessions:
    • Q92853
    • Q9BW87

    Protein attributes for PLD3 Gene

    Size:
    490 amino acids
    Molecular mass:
    54705 Da
    Quaternary structure:
    • Interacts with APP.
    SequenceCaution:
    • Sequence=AAB16799.1; Type=Frameshift; Positions=52; Evidence={ECO:0000305};

neXtProt entry for PLD3 Gene

Selected DME Specific Peptides for PLD3 Gene

Q8IV08:
  • DTRYNQETPMEICLNGTPALAYLASAPPPLCP
  • YNCSCLA
  • DNHTHSDIQVKLFVVP
  • DIASFYW
  • YIGTSNWSG
  • LHTKFWVVD
  • VRLLISCW
  • KIFEAYW
  • GRTPDLKALL
  • IPYARVNHNKYMVT
  • GSANMDW
  • LARDLTK
  • SAQQGEEVLRQLQTLAP
  • ELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFL
  • LVESIPE

Post-translational modifications for PLD3 Gene

  • Glycosylated.
  • Ubiquitination at posLast=1111, posLast=157157, and posLast=309309
  • Glycosylation at Asn97, posLast=132132, Asn236, and posLast=387387
  • Modification sites at PhosphoSitePlus

Domains & Families for PLD3 Gene

Gene Families for PLD3 Gene

Protein Domains for PLD3 Gene

Graphical View of Domain Structure for InterPro Entry

Q8IV08

UniProtKB/Swiss-Prot:

PLD3_HUMAN :
  • Belongs to the phospholipase D family.
Family:
  • Belongs to the phospholipase D family.
genes like me logo Genes that share domains with PLD3: view

Function for PLD3 Gene

Molecular function for PLD3 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
A phosphatidylcholine + H(2)O = choline + a phosphatidate.
UniProtKB/Swiss-Prot Function:
May be involved in APP processing.

Enzyme Numbers (IUBMB) for PLD3 Gene

Gene Ontology (GO) - Molecular Function for PLD3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004630 phospholipase D activity TAS,IEA --
GO:0005515 protein binding IPI 20195357
GO:0016787 hydrolase activity IEA --
GO:0070290 N-acylphosphatidylethanolamine-specific phospholipase D activity IEA --
genes like me logo Genes that share ontologies with PLD3: view
genes like me logo Genes that share phenotypes with PLD3: view

Animal Models for PLD3 Gene

MGI Knock Outs for PLD3:
  • Pld3 tm1e(EUCOMM)Wtsi

Animal Model Products

miRNA for PLD3 Gene

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PLD3 Gene

Localization for PLD3 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PLD3 Gene

Endoplasmic reticulum membrane; Single-pass type II membrane protein.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PLD3 gene
Compartment Confidence
extracellular 5
endoplasmic reticulum 4
plasma membrane 3
nucleus 2
cytosol 2

Gene Ontology (GO) - Cellular Components for PLD3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005783 endoplasmic reticulum IEA --
GO:0005789 endoplasmic reticulum membrane IEA --
GO:0016020 membrane IEA --
GO:0016021 integral component of membrane IEA --
GO:0070062 extracellular exosome IDA 19056867
genes like me logo Genes that share ontologies with PLD3: view

Pathways & Interactions for PLD3 Gene

genes like me logo Genes that share pathways with PLD3: view

Gene Ontology (GO) - Biological Process for PLD3 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0016042 lipid catabolic process IEA --
genes like me logo Genes that share ontologies with PLD3: view

No data available for SIGNOR curated interactions for PLD3 Gene

Drugs & Compounds for PLD3 Gene

(3) Drugs for PLD3 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
Choline Approved Nutra 154
Ethanolamine Experimental Pharma 0

(8) Additional Compounds for PLD3 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
PC(18:1(9Z)e/2:0)
  • (2-acetyloxy-3-octadec-9-enoxypropyl) 2-trimethylazaniumylethyl phosphate
  • 2-Acetyl-1-(9Z-octadecenyl)-sn-glycero-3-phosphocholine
  • PC(O-18:1(9Z)/2:0)
PE(P-16:0e/16:0)
  • 2-Hexadecanoyl-1-(1Z-hexadecenyl)-sn-glycero-3-phosphoethanolamine
PEP-16:0/18:1(11Z))
  • 1-(1-Enyl-palmitoyl)-2-vaccenoyl-sn-glycero-3-phosphoethanolamine
  • GPEtn(16:0/18:1)
  • GPEtn(16:0/18:1n7)
  • GPEtn(16:0/18:1w7)
  • GPEtn(34:1)
Phosphatidylcholines Group A
  • (Z,Z)-(1)-(7-Oleoyl-4-oxido-10-oxo-3,5,9-trioxa-4-phosphaheptacos-18-enyl)trimethylammonium 4-oxide
  • (Z,Z)-4-hydroxy-N,N,N-trimethyl-10-oxo-7-[(1-oxo-9-octadecenyl)oxy]-3,5,9-Trioxa-4-phosphaheptacos-18-en-1-aminium 4-oxide hydroxide inner salt
  • 1,2-Dioleoyl-rac-glycero-3-phosphocholine
  • 1,2-Dioleoylglycerol-3-phosphorylcholine
  • 1,2-Dioleoylglyceryl-3-phosphorylcholine
68737-67-7
Phosphatidylcholines Group B
  • 1-(1-Enyl-vaccenoyl)-2-stearidonoyl-sn-glycero-3-phosphocholine
  • GPCho(18:1/18:4)
  • GPCho(18:1n7/18:4n3)
  • GPCho(18:1w7/18:4w3)
  • GPCho(36:5)
88542-95-4
genes like me logo Genes that share compounds with PLD3: view

Transcripts for PLD3 Gene

Unigene Clusters for PLD3 Gene

Phospholipase D family, member 3:
Representative Sequences:

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for PLD3 Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3 ^ 4a · 4b · 4c · 4d · 4e ^ 5 ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9a · 9b · 9c ^ 10a · 10b ^ 11a · 11b ^ 12 ^ 13a · 13b ^
SP1: - - - - -
SP2: - - - - - - - -
SP3: - - - - - - - - - -
SP4: - - - - - - -
SP5: - - - - - - - -
SP6: - - - - - - - - -
SP7: - -
SP8: - -
SP9:
SP10: - - - -
SP11: - - -
SP12: - -
SP13: - -
SP14: - - - -
SP15:
SP16: -
SP17: - - -

ExUns: 14a · 14b ^ 15a · 15b · 15c ^ 16 ^ 17 ^ 18a · 18b · 18c
SP1: -
SP2: -
SP3:
SP4: - -
SP5:
SP6:
SP7:
SP8:
SP9: -
SP10: