Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PLD1 Gene

Aliases for PLD1 Gene

  • Phospholipase D1 2 3 5
  • Choline Phosphatase 1 2 4
  • EC 3.1.4.4 4 61
  • Phosphatidylcholine-Hydrolyzing Phospholipase D1 4
  • Phospholipase D1, Phosphatidylcholine-Specific 2
  • PLD 1 4
  • HPLD1 4

External Ids for PLD1 Gene

Previous GeneCards Identifiers for PLD1 Gene

  • GC03M168371
  • GC03M172277
  • GC03M172722
  • GC03M172641
  • GC03M172636
  • GC03M172801
  • GC03M171318
  • GC03M168688

Summaries for PLD1 Gene

Entrez Gene Summary for PLD1 Gene

  • This gene encodes a phosphatidylcholine-specific phospholipase which catalyzes the hydrolysis of phosphatidylcholine in order to yield phosphatidic acid and choline. The enzyme may play a role in signal transduction and subcellular trafficking. Alternative splicing results in multiple transcript variants with both catalytic and regulatory properties. [provided by RefSeq, Sep 2011]

GeneCards Summary for PLD1 Gene

PLD1 (Phospholipase D1) is a Protein Coding gene. Among its related pathways are GPCR Pathway and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include phosphatidylinositol binding and N-acylphosphatidylethanolamine-specific phospholipase D activity. An important paralog of this gene is PLD2.

UniProtKB/Swiss-Prot for PLD1 Gene

  • Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic (By similarity).

Tocris Summary for PLD1 Gene

  • Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. There are four major classes; phospholipase A, phospholipase B, phosphoinositide-specific phospholipase C and phospholipase D.

Gene Wiki entry for PLD1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PLD1 Gene

Genomics for PLD1 Gene

Regulatory Elements for PLD1 Gene

Enhancers for PLD1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH03G171787 1.5 Ensembl ENCODE dbSUPER 28.5 +20.5 20532 5.9 FOXA2 FEZF1 ZNF2 GATA2 ELK1 FOS TSHZ1 REST ZNF623 TBX21 PLD1 TMEM212 FNDC3B ECT2 ENSG00000234594
GH03G171804 2 FANTOM5 Ensembl ENCODE dbSUPER 19.1 +2.3 2263 9.3 MLX CREB3L1 FEZF1 DMAP1 YY1 SLC30A9 ZNF263 SP3 TBX21 MEF2D PLD1 FNDC3B TMEM212 ECT2 TNIK ENSG00000234594
GH03G171781 1.2 Ensembl ENCODE dbSUPER 26.1 +28.6 28574 2.3 ESRRA PKNOX1 BHLHE40 ZNF7 ZNF664 HIC1 PRDM6 ZNF366 IKZF1 BCL6B PLD1 TMEM212 ECT2 ENSG00000234594
GH03G171800 1.8 FANTOM5 Ensembl ENCODE dbSUPER 16.4 +9.0 8989 3.0 HDGF PKNOX1 FEZF1 ZNF2 ZNF121 FOS TSHZ1 TBX21 MAFF AEBP2 PLD1 TMEM212 FNDC3B ENSG00000234594
GH03G171776 1.5 FANTOM5 Ensembl ENCODE dbSUPER 18.3 +33.7 33650 2.2 HDGF RAD51 PKNOX1 ZNF610 WRNIP1 ZMYM3 PRDM10 PRDM1 ZKSCAN1 PLD1 FNDC3B TMEM212 ENSG00000234594
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PLD1 on UCSC Golden Path with GeneCards custom track

Promoters for PLD1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000161832 750 1601 FOXA2 MLX ARNT WRNIP1 ARID4B SIN3A FEZF1 ZNF2 YY1 ZNF766

Genomic Location for PLD1 Gene

Chromosome:
3
Start:
171,600,405 bp from pter
End:
171,810,950 bp from pter
Size:
210,546 bases
Orientation:
Minus strand

Genomic View for PLD1 Gene

Genes around PLD1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PLD1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PLD1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PLD1 Gene

Proteins for PLD1 Gene

  • Protein details for PLD1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q13393-PLD1_HUMAN
    Recommended name:
    Phospholipase D1
    Protein Accession:
    Q13393

    Protein attributes for PLD1 Gene

    Size:
    1074 amino acids
    Molecular mass:
    124184 Da
    Quaternary structure:
    • Interacts with PIP5K1B.

    Alternative splice isoforms for PLD1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PLD1 Gene

Selected DME Specific Peptides for PLD1 Gene

Q13393:
  • EYQAGRFA
  • KEVELAL
  • TAHELRYQVPG
  • YIENQFF
  • HYIYIENQ
  • ARHFIQRWNFTK
  • SQLSFIHDLGPKG
  • KDWVQLD
  • VKDSFLLYM
  • LHPNIKVMRHPD
  • MDGKEYQAG
  • HSKLLIADD
  • LWAHHEKL
  • IGSANIN
  • FLKDHRFGSYAA
  • KYRSLSYPFLLPKSQ
  • LGKRDSE
  • EEIFITDWWLSPE
  • LAKWYVNAKGYFED
  • LPGFEGDISTGGGN
  • DLAYGRWDD
  • EEPREMPSLPRSSEN
  • RHTFRRQNV
  • HHEKLVI
  • GRRKQLEDYLTKILKMPMYRNYHATTEFLD
  • CYRWSKRWL
  • WQVKRKFKHFQEFHRELLKYKAFIRIPIPT

Post-translational modifications for PLD1 Gene

  • Ubiquitination at posLast=189189
  • Modification sites at PhosphoSitePlus

Domains & Families for PLD1 Gene

Gene Families for PLD1 Gene

Suggested Antigen Peptide Sequences for PLD1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q13393

UniProtKB/Swiss-Prot:

PLD1_HUMAN :
  • Belongs to the phospholipase D family.
Family:
  • Belongs to the phospholipase D family.
genes like me logo Genes that share domains with PLD1: view

Function for PLD1 Gene

Molecular function for PLD1 Gene

GENATLAS Biochemistry:
phospholipase D1,phosphatidylcholine specific,membrane associated,activated by ADP-ribosylation factor 1 by protein kinase C alpha,and Rho A,involved in inflammation,metabolic regulation,oncogenesis,neural and cardiac stimulation
UniProtKB/Swiss-Prot CatalyticActivity:
A phosphatidylcholine + H(2)O = choline + a phosphatidate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Stimulated by phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate, activated by the phosphokinase C-alpha, by the ADP-ribosylation factor-1 (ARF-1), and to a lesser extent by GTP-binding proteins: RHO A, RAC-1 and CDC42. Inhibited by oleate.
UniProtKB/Swiss-Prot Function:
Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic (By similarity).

Enzyme Numbers (IUBMB) for PLD1 Gene

Gene Ontology (GO) - Molecular Function for PLD1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003824 catalytic activity IEA --
GO:0004630 phospholipase D activity TAS --
GO:0005515 protein binding IPI 17853892
GO:0016787 hydrolase activity IEA --
GO:0035091 phosphatidylinositol binding IEA --
genes like me logo Genes that share ontologies with PLD1: view
genes like me logo Genes that share phenotypes with PLD1: view

Animal Models for PLD1 Gene

MGI Knock Outs for PLD1:

Animal Model Products

miRNA for PLD1 Gene

miRTarBase miRNAs that target PLD1

Inhibitory RNA Products

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PLD1 Gene

Localization for PLD1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PLD1 Gene

Cytoplasm, perinuclear region. Endoplasmic reticulum membrane; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Late endosome membrane; Lipid-anchor; Cytoplasmic side.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PLD1 gene
Compartment Confidence
plasma membrane 5
lysosome 5
golgi apparatus 5
endosome 5
nucleus 4
endoplasmic reticulum 4
cytosol 4

Gene Ontology (GO) - Cellular Components for PLD1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane IEA --
GO:0005737 cytoplasm IEA --
GO:0005765 lysosomal membrane IDA 17897319
GO:0005768 endosome IDA 14718562
GO:0005783 endoplasmic reticulum IEA --
genes like me logo Genes that share ontologies with PLD1: view

Pathways & Interactions for PLD1 Gene

genes like me logo Genes that share pathways with PLD1: view

SIGNOR curated interactions for PLD1 Gene

Is activated by:

Gene Ontology (GO) - Biological Process for PLD1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006629 lipid metabolic process IEA --
GO:0006654 phosphatidic acid biosynthetic process TAS --
GO:0006935 chemotaxis TAS 10848592
GO:0007264 small GTPase mediated signal transduction TAS 8530346
GO:0007265 Ras protein signal transduction TAS 10848592
genes like me logo Genes that share ontologies with PLD1: view

Drugs & Compounds for PLD1 Gene

(25) Drugs for PLD1 Gene - From: DrugBank, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Choline Approved Nutra Target, product of 154
Miltefosine Approved Pharma Enzyme, substrate PI3K/Akt inhibitor 35
Water Approved Pharma 0
Ethanolamine Experimental Pharma 0
Guanosine triphosphate Experimental Pharma 0

(31) Additional Compounds for PLD1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
PC(18:1(9Z)e/2:0)
  • (2-acetyloxy-3-octadec-9-enoxypropyl) 2-trimethylazaniumylethyl phosphate
  • 2-Acetyl-1-(9Z-octadecenyl)-sn-glycero-3-phosphocholine
  • PC(O-18:1(9Z)/2:0)
PE(P-16:0e/16:0)
  • 2-Hexadecanoyl-1-(1Z-hexadecenyl)-sn-glycero-3-phosphoethanolamine
PEP-16:0/18:1(11Z))
  • 1-(1-Enyl-palmitoyl)-2-vaccenoyl-sn-glycero-3-phosphoethanolamine
  • GPEtn(16:0/18:1)
  • GPEtn(16:0/18:1n7)
  • GPEtn(16:0/18:1w7)
  • GPEtn(34:1)
Phosphatidylcholines Group A
  • (Z,Z)-(1)-(7-Oleoyl-4-oxido-10-oxo-3,5,9-trioxa-4-phosphaheptacos-18-enyl)trimethylammonium 4-oxide
  • (Z,Z)-4-hydroxy-N,N,N-trimethyl-10-oxo-7-[(1-oxo-9-octadecenyl)oxy]-3,5,9-Trioxa-4-phosphaheptacos-18-en-1-aminium 4-oxide hydroxide inner salt
  • 1,2-Dioleoyl-rac-glycero-3-phosphocholine
  • 1,2-Dioleoylglycerol-3-phosphorylcholine
  • 1,2-Dioleoylglyceryl-3-phosphorylcholine
68737-67-7
Phosphatidylcholines Group B
  • 1-(1-Enyl-vaccenoyl)-2-stearidonoyl-sn-glycero-3-phosphocholine
  • GPCho(18:1/18:4)
  • GPCho(18:1n7/18:4n3)
  • GPCho(18:1w7/18:4w3)
  • GPCho(36:5)
88542-95-4

(5) Tocris Compounds for PLD1 Gene

Compound Action Cas Number
D609 Selective PC-PLC inhibitor 83373-60-8
m-3M3FBS Phospholipase C activator 200933-14-8
U 73343 Analog of U 73122 (Cat. No. 1268) 142878-12-4
VU 0155069 Potent and selective PLD1 inhibitor 1130067-06-9
VU 0364739 hydrochloride Potent and selective PLD2 inhibitor 1244640-48-9
genes like me logo Genes that share compounds with PLD1: view

Transcripts for PLD1 Gene

Unigene Clusters for PLD1 Gene

Phospholipase D1, phosphatidylcholine-specific:
Representative Sequences:

Inhibitory RNA Products

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for PLD1 Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17a · 17b ^ 18 ^ 19 ^ 20 ^ 21 ^ 22 ^ 23 ^ 24a ·
SP1: - - -
SP2: - - - -
SP3:
SP4:

ExUns: 24b ^ 25 ^ 26a · 26b ^ 27 ^ 28a · 28b
SP1:
SP2:
SP3:
SP4:

Relevant External Links for PLD1 Gene

GeneLoc Exon Structure for
PLD1
ECgene alternative splicing isoforms for
PLD1

Expression for PLD1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PLD1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for PLD1 Gene

This gene is overexpressed in Cervix (26.1) and Adrenal (13.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PLD1 Gene



NURSA nuclear receptor signaling pathways regulating expression of PLD1 Gene:

PLD1

SOURCE GeneReport for Unigene cluster for PLD1 Gene:

Hs.382865

mRNA Expression by UniProt/SwissProt for PLD1 Gene:

Q13393-PLD1_HUMAN
Tissue specificity: Expressed abundantly in the pancreas and heart and at high levels in brain, placenta, spleen, uterus and small intestine.

Evidence on tissue expression from TISSUES for PLD1 Gene

  • Nervous system(4.4)
  • Liver(4.3)
  • Muscle(4.2)
genes like me logo Genes that share expression patterns with PLD1: view

Primer Products

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PLD1 Gene

Orthologs for PLD1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PLD1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PLD1 34 35
  • 99.41 (n)
cow
(Bos Taurus)
Mammalia PRKCSH 35
  • 92 (a)
OneToOne
PLD1 34
  • 91 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 35
  • 91 (a)
OneToMany
-- 35
  • 81 (a)
OneToMany
-- 35
  • 79 (a)
OneToMany
-- 35
  • 75 (a)
OneToMany
-- 35
  • 73 (a)
OneToMany
oppossum
(Monodelphis domestica)
Mammalia PLD1 35
  • 90 (a)
OneToOne
dog
(Canis familiaris)
Mammalia PLD1 34 35
  • 87.8 (n)
mouse
(Mus musculus)
Mammalia Pld1 34 16 35
  • 84.68 (n)
rat
(Rattus norvegicus)
Mammalia Pld1 34
  • 84.46 (n)
chicken
(Gallus gallus)
Aves PLD1 34 35
  • 74.54 (n)
lizard
(Anolis carolinensis)
Reptilia PLD1 35
  • 30 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pld1 34
  • 72.92 (n)
zebrafish
(Danio rerio)
Actinopterygii pld1b 35
  • 68 (a)
OneToMany
pld1a 34 35
  • 67.07 (n)
fruit fly
(Drosophila melanogaster)
Insecta Pld 36 35
  • 46 (a)
worm
(Caenorhabditis elegans)
Secernentea pld-1