Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PLCG1 Gene

Aliases for PLCG1 Gene

  • Phospholipase C Gamma 1 2 3 5
  • Phospholipase C, Gamma 1 (Formerly Subtype 148) 2 3
  • Phosphoinositide Phospholipase C-Gamma-1 3 4
  • Phospholipase C-II 3 4
  • PLC-Gamma-1 3 4
  • EC 3.1.4.11 4 56
  • PLC-148 3 4
  • PLC-II 3 4
  • PLC1 3 4
  • 1-Phosphatidylinositol 4,5-Bisphosphate Phosphodiesterase Gamma-1 3
  • 1-Phosphatidyl-D-Myo-Inositol-4,5-Bisphosphate 3
  • Monophosphatidylinositol Phosphodiesterase 3
  • Triphosphoinositide Phosphodiesterase 3
  • Phosphatidylinositol Phospholipase C 3
  • Phosphoinositide Phospholipase C 3
  • Inositoltrisphosphohydrolase 3
  • Phospholipase C, Gamma 1 2
  • Phospholipase C-Gamma-1 4
  • Phosphoinositidase C 3
  • Phospholipase C-148 3
  • PLCgamma1 3
  • NCKAP3 3
  • PLC148 3

External Ids for PLCG1 Gene

Previous HGNC Symbols for PLCG1 Gene

  • PLC1

Previous GeneCards Identifiers for PLCG1 Gene

  • GC20P039494
  • GC20P040404
  • GC20P040451
  • GC20P039199
  • GC20P039765
  • GC20P036506

Summaries for PLCG1 Gene

Entrez Gene Summary for PLCG1 Gene

  • The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for PLCG1 Gene

PLCG1 (Phospholipase C Gamma 1) is a Protein Coding gene. Diseases associated with PLCG1 include Paroxysmal Nocturnal Hemoglobinuria and Mycobacterium Kansasii. Among its related pathways are G-protein signaling N-RAS regulation pathway and RET signaling. Gene Ontology (GO) annotations related to this gene include calcium ion binding and signal transducer activity. An important paralog of this gene is PLCG2.

UniProtKB/Swiss-Prot for PLCG1 Gene

  • Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, FGFR1, FGFR2, FGFR3 and FGFR4. Plays a role in actin reorganization and cell migration.

Tocris Summary for PLCG1 Gene

  • Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. There are four major classes; phospholipase A, phospholipase B, phosphoinositide-specific phospholipase C and phospholipase D.

Gene Wiki entry for PLCG1 Gene

Additional gene information for PLCG1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PLCG1 Gene

Genomics for PLCG1 Gene

GeneHancer (GH) Regulatory Elements for PLCG1 Gene

Promoters and enhancers for PLCG1 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH20I041136 Promoter/Enhancer 2.5 EPDnew FANTOM5 Ensembl ENCODE dbSUPER 552.1 +3.0 2966 7.5 HDGF PKNOX1 CLOCK MLX ARNT ARID4B NEUROD1 SIN3A DMAP1 ZBTB7B PLCG1 PLCG1-AS1 LPIN3 CHD6 GC20P041111 MIR6871
GH20I041135 Enhancer 1.1 ENCODE dbSUPER 550.8 -1.4 -1408 0.5 ATF1 ZFP64 ARID4B NEUROD1 SIN3A ZNF143 RUNX3 SP5 REST KAT8 PLCG1 TOP1 PLCG1-AS1 GC20P041111
GH20I041313 Promoter/Enhancer 1.8 Ensembl ENCODE dbSUPER 30.7 +179.9 179944 5.9 HDGF PKNOX1 FOXA2 MLX ARID4B SIN3A DMAP1 ZNF2 ZBTB7B YY1 ZHX3 PLCG1 CHD6 LPIN3 PLCG1-AS1 TOP1 GC20M041291 RN7SL615P
GH20I041001 Enhancer 1.8 FANTOM5 Ensembl ENCODE dbSUPER 20.1 -131.0 -131021 9.1 CLOCK MLX YBX1 FEZF1 DMAP1 SLC30A9 ZNF143 NFYC MEF2D SSRP1 LOC105372621 CHD6 PLCG1 MAFB TOP1 PLCG1-AS1 LPIN3 EMILIN3 GC20M041019 LOC100128988
GH20I040686 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE dbSUPER 12.5 -448.6 -448584 4.8 PKNOX1 SIN3A ZBTB7B ZNF48 YY1 GLIS2 ZNF143 KLF7 SP3 RXRA GC20M040687 MAFB CHD6 PLCG1
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around PLCG1 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the PLCG1 gene promoter:

Genomic Locations for PLCG1 Gene

Genomic Locations for PLCG1 Gene
chr20:41,136,960-41,196,801
(GRCh38/hg38)
Size:
59,842 bases
Orientation:
Plus strand
chr20:39,765,600-39,811,629
(GRCh37/hg19)

Genomic View for PLCG1 Gene

Genes around PLCG1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PLCG1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PLCG1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PLCG1 Gene

Proteins for PLCG1 Gene

  • Protein details for PLCG1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P19174-PLCG1_HUMAN
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
    Protein Accession:
    P19174
    Secondary Accessions:
    • B7ZLY7
    • B9EGH4
    • E1P5W4
    • Q2V575

    Protein attributes for PLCG1 Gene

    Size:
    1290 amino acids
    Molecular mass:
    148532 Da
    Cofactor:
    Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
    Quaternary structure:
    • Interacts with AGAP2 via its SH3 domain. Interacts (via SH2 domain) with RET. Interacts with FLT1 (tyrosine-phosphorylated) (By similarity). Interacts (via SH2 domain) with FGFR1, FGFR2, FGFR3 and FGFR4 (phosphorylated). Interacts with LAT (phosphorylated) upon TCR activation. Interacts (via SH3 domain) with the Pro-rich domain of TNK1. Associates with BLNK, VAV1, GRB2 and NCK1 in a B-cell antigen receptor-dependent fashion. Interacts with CBLB in activated T-cells; which inhibits phosphorylation. Interacts with SHB. Interacts (via SH3 domain) with the Arg/Gly-rich-flanked Pro-rich domains of KHDRBS1/SAM68. This interaction is selectively regulated by arginine methylation of KHDRBS1/SAM68. Interacts with INPP5D/SHIP1, THEMIS and CLNK (By similarity). Interacts with AXL, FLT4 and KIT. Interacts with RALGPS1. Interacts (via SH3 domain) with HEV ORF3 protein. Interacts (via the SH2 domains) with VIL1 (phosphorylated at C-terminus tyrosine phosphorylation sites). Interacts (via SH2 domain) with PDGFRA and PDGFRB (tyrosine phosphorylated). Interacts with PIP5K1C (By similarity). Interacts with NTRK1 and NTRK2 (phosphorylated upon ligand-binding). Interacts with SYK; activates PLCG1. Interacts with GRB2, LAT and THEMIS upon TCR activation in thymocytes (By similarity). Interacts with TESPA1; the association is increased with prolonged stimulation of the TCR and may facilitate the assembly of the LAT signalosome.

    Three dimensional structures from OCA and Proteopedia for PLCG1 Gene

    Alternative splice isoforms for PLCG1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PLCG1 Gene

Selected DME Specific Peptides for PLCG1 Gene

P19174:
  • MYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYY
  • SEYPVILS
  • VYEEDMFSD
  • GCRCIELDCWDGPDG
  • KQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEE
  • QLSRIYP
  • VLGARHLPK
  • DYTLSFWR
  • SSHNTYL
  • VALNFQT
  • ENGDLSPF
  • YHGHTLT
  • EIKEIRPGK

Post-translational modifications for PLCG1 Gene

  • Tyrosine phosphorylated in response to signaling via activated FLT3, KIT and PDGFRA (By similarity). Tyrosine phosphorylated by activated FGFR1, FGFR2, FGFR3 and FGFR4. Tyrosine phosphorylated by activated FLT1 and KDR. Tyrosine phosphorylated by activated PDGFRB. The receptor-mediated activation of PLCG1 involves its phosphorylation by tyrosine kinases, in response to ligation of a variety of growth factor receptors and immune system receptors. For instance, SYK phosphorylates and activates PLCG1 in response to ligation of the B-cell receptor. May be dephosphorylated by PTPRJ. Phosphorylated by ITK and TXK on Tyr-783 upon TCR activation in T-cells.
  • Ubiquitinated by CBLB in activated T-cells.
  • Ubiquitination at isoforms=2178, Lys226, Lys431, isoforms=2440, and Lys941

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for PLCG1 (PLCG1)

Domains & Families for PLCG1 Gene

Suggested Antigen Peptide Sequences for PLCG1 Gene

Graphical View of Domain Structure for InterPro Entry

P19174

UniProtKB/Swiss-Prot:

PLCG1_HUMAN :
  • The SH3 domain mediates interaction with CLNK (By similarity). The SH3 domain also mediates interaction with RALGPS1.
Domain:
  • The SH3 domain mediates interaction with CLNK (By similarity). The SH3 domain also mediates interaction with RALGPS1.
genes like me logo Genes that share domains with PLCG1: view

Function for PLCG1 Gene

Molecular function for PLCG1 Gene

GENATLAS Biochemistry:
phospholipase C,gamma 1 (subtype 148),phosphatidylinositol specific,involved in signal transduction,directly interacting with phosphorylated PTK2 to promote adhesion-dependent association of the two molecules and increase inositol-phosphate production (mouse fibroblasts)
UniProtKB/Swiss-Prot CatalyticActivity:
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H(2)O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by phosphorylation on tyrosine residues.
UniProtKB/Swiss-Prot Function:
Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, FGFR1, FGFR2, FGFR3 and FGFR4. Plays a role in actin reorganization and cell migration.

Enzyme Numbers (IUBMB) for PLCG1 Gene

Phenotypes From GWAS Catalog for PLCG1 Gene

Gene Ontology (GO) - Molecular Function for PLCG1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004435 phosphatidylinositol phospholipase C activity TAS,IEA --
GO:0004629 phospholipase C activity TAS --
GO:0004871 signal transducer activity IEA --
GO:0005057 signal transducer activity, downstream of receptor NAS 7681365
GO:0005168 neurotrophin TRKA receptor binding IPI 15488758
genes like me logo Genes that share ontologies with PLCG1: view
genes like me logo Genes that share phenotypes with PLCG1: view

Animal Models for PLCG1 Gene

MGI Knock Outs for PLCG1:

miRNA for PLCG1 Gene

miRTarBase miRNAs that target PLCG1

Clone Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PLCG1 Gene

Localization for PLCG1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PLCG1 Gene

Cell projection, lamellipodium. Cell projection, ruffle. Note=Rapidly redistributed to ruffles and lamellipodia structures in response to epidermal growth factor (EGF) treatment.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PLCG1 gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 5
extracellular 2
cytoskeleton 2
endoplasmic reticulum 2
endosome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PLCG1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001726 ruffle IEA,IDA 17229814
GO:0005622 intracellular IEA --
GO:0005737 cytoplasm IDA 15702972
GO:0005829 cytosol TAS --
GO:0005886 plasma membrane TAS --
genes like me logo Genes that share ontologies with PLCG1: view

Pathways & Interactions for PLCG1 Gene

SuperPathways for PLCG1 Gene

SuperPathway Contained pathways
1 RET signaling
2 Downstream signaling of activated FGFR2
3 IL-2 Pathway
4 Immune response Fc epsilon RI pathway
5 Inositol phosphate metabolism (KEGG)
genes like me logo Genes that share pathways with PLCG1: view

Pathways by source for PLCG1 Gene

SIGNOR curated interactions for PLCG1 Gene

Gene Ontology (GO) - Biological Process for PLCG1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000186 activation of MAPKK activity TAS --
GO:0001701 in utero embryonic development IEA --
GO:0006629 lipid metabolic process IEA --
GO:0007165 signal transduction TAS,IEA --
GO:0007173 epidermal growth factor receptor signaling pathway IMP 22454520
genes like me logo Genes that share ontologies with PLCG1: view

Drugs & Compounds for PLCG1 Gene

(46) Drugs for PLCG1 Gene - From: PharmGKB, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
calcium Approved Nutra 0
Acetaminophen Approved Pharma 1014
Aspirin Approved, Vet_approved Pharma Channel blocker 1232
Diclofenac Approved, Vet_approved Pharma Channel blocker 340
Water Approved Pharma 0

(427) Additional Compounds for PLCG1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Phosphatidylinositol-3,4,5-trisphosphate
  • 1,2-Diacyl-sn-glycero-3-phospho-(1'-myo-inositol-3',4',5'-bisphosphate)
  • 1-Phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate
  • Phosphatidylinositol-3,4,5-trisphosphate
U 73122
112648-68-7
Diglycerides Group A
  • 1-Myristoyl-2-pentadecanoyl-sn-glycerol
  • DAG(14:0/15:0)
  • DAG(29:0)
  • DG(14:0/15:0)
  • DG(29:0)
Diglycerides Group B
  • 1-Palmitoleoyl-2-arachidonoyl-sn-glycerol
  • DAG(16:1/20:4)
  • DAG(16:1n7/20:4n6)
  • DAG(16:1w7/20:4w6)
  • DAG(36:5)
Diglycerides Group C
  • 1-Pentadecanoyl-3-behenoyl-sn-glycerol
  • 1-Pentadecanoyl-3-docosanoyl-sn-glycerol
  • DAG(15:0/0:0/22:0)
  • DAG(37:0)
  • DG(37:0)

(5) Tocris Compounds for PLCG1 Gene

Compound Action Cas Number
AACOCF3 Phospholipase A2 inhibitor 149301-79-1
Edelfosine Selective PI-PLC inhibitor, also PAF receptor agonist 77286-66-9
m-3M3FBS Phospholipase C activator 200933-14-8
o-3M3FBS Inactive analog of m-3M3FBS (Cat. No. 1941) 313981-55-4
U 73122 Phospholipase C inhibitor 112648-68-7
genes like me logo Genes that share compounds with PLCG1: view

Transcripts for PLCG1 Gene

Unigene Clusters for PLCG1 Gene

Phospholipase C, gamma 1:
Representative Sequences:

Clone Products

Alternative Splicing Database (ASD) splice patterns (SP) for PLCG1 Gene

ExUns: 1 ^ 2a · 2b · 2c · 2d ^ 3a · 3b ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10a · 10b ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16a · 16b ^ 17 ^ 18a ·
SP1: - - -
SP2:
SP3:
SP4: - -
SP5: -
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12:

ExUns: 18b ^ 19 ^ 20 ^ 21a · 21b ^ 22a · 22b ^ 23 ^ 24 ^ 25a · 25b ^ 26a · 26b ^ 27 ^ 28a · 28b · 28c ^ 29 ^ 30 ^ 31 ^ 32 ^ 33a · 33b ^ 34a · 34b
SP1: - - - -
SP2: - -
SP3:
SP4:
SP5: