Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PLCG1 Gene

Aliases for PLCG1 Gene

  • Phospholipase C Gamma 1 2 3 5
  • Phospholipase C, Gamma 1 (Formerly Subtype 148) 2 3
  • Phosphoinositide Phospholipase C-Gamma-1 3 4
  • Phospholipase C-II 3 4
  • PLC-Gamma-1 3 4
  • EC 3.1.4.11 4 61
  • PLC-148 3 4
  • PLC-II 3 4
  • PLC1 3 4
  • 1-Phosphatidylinositol 4,5-Bisphosphate Phosphodiesterase Gamma-1 3
  • 1-Phosphatidyl-D-Myo-Inositol-4,5-Bisphosphate 3
  • Monophosphatidylinositol Phosphodiesterase 3
  • Triphosphoinositide Phosphodiesterase 3
  • Phosphatidylinositol Phospholipase C 3
  • Phosphoinositide Phospholipase C 3
  • Inositoltrisphosphohydrolase 3
  • Phospholipase C, Gamma 1 2
  • Phospholipase C-Gamma-1 4
  • Phosphoinositidase C 3
  • Phospholipase C-148 3
  • PLCgamma1 3
  • NCKAP3 3
  • PLC148 3

External Ids for PLCG1 Gene

Previous HGNC Symbols for PLCG1 Gene

  • PLC1

Previous GeneCards Identifiers for PLCG1 Gene

  • GC20P039494
  • GC20P040404
  • GC20P040451
  • GC20P039199
  • GC20P039765
  • GC20P036506

Summaries for PLCG1 Gene

Entrez Gene Summary for PLCG1 Gene

  • The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for PLCG1 Gene

PLCG1 (Phospholipase C Gamma 1) is a Protein Coding gene. Diseases associated with PLCG1 include Mycobacterium Kansasii and Cd45 Deficiency. Among its related pathways are ICos-ICosL Pathway in T-Helper Cell and CTLA4 Signaling. GO annotations related to this gene include calcium ion binding and signal transducer activity. An important paralog of this gene is PLCG2.

UniProtKB/Swiss-Prot for PLCG1 Gene

  • Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, FGFR1, FGFR2, FGFR3 and FGFR4. Plays a role in actin reorganization and cell migration.

Tocris Summary for PLCG1 Gene

  • Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. There are four major classes; phospholipase A, phospholipase B, phosphoinositide-specific phospholipase C and phospholipase D.

Gene Wiki entry for PLCG1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PLCG1 Gene

Genomics for PLCG1 Gene

Regulatory Elements for PLCG1 Gene

Enhancers for PLCG1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH20G041001 2 FANTOM5 Ensembl ENCODE dbSUPER 10.2 -131.0 -131022 9.1 MLX ZFP64 YBX1 FEZF1 DMAP1 SLC30A9 ZNF143 NFYC MEF2D SSRP1 MAFB TOP1 PLCG1-AS1 PLCG1 LPIN3 EMILIN3 LOC105372621 GC20M041019
GH20G041145 1.9 FANTOM5 Ensembl ENCODE dbSUPER 9.9 +16.1 16131 15.3 HDGF PKNOX1 FOXA2 ATF1 ARID4B SIN3A YBX1 TCF12 GATA2 FOS LPIN3 EMILIN3 ZHX3 PLCG1 CHD6 MIR6871 PLCG1-AS1
GH20G041307 1.6 FANTOM5 Ensembl ENCODE dbSUPER 10.1 +172.2 172248 3.0 HDGF PKNOX1 TAL1 CEBPG YBX1 TCF12 NCOR1 PRDM10 TRIM24 CREM LPIN3 EMILIN3 PLCG1 PLCG1-AS1 ZHX3 GC20M041291 RN7SL615P
GH20G041171 1.3 Ensembl ENCODE dbSUPER 11.8 +38.6 38618 7.9 HDGF RB1 TBL1XR1 ARID4B SIN3A ZNF48 RAD21 ELK1 SCRT2 ZNF143 LPIN3 PLCG1-AS1 PLCG1 EMILIN3 ZHX3 PIR61254 MIR6871
GH20G041116 1.2 ENCODE dbSUPER 12 -20.5 -20509 0.8 HDAC1 PKNOX1 ATF1 TBL1XR1 ARNT BMI1 TCF12 GATA2 CREM PAF1 PLCG1 PLCG1-AS1 TOP1 GC20P041111
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PLCG1 on UCSC Golden Path with GeneCards custom track

Promoters for PLCG1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000137271 740 2201 HDGF HNRNPUL1 PKNOX1 MLX ARNT ARID4B SIN3A DMAP1 ZBTB7B SLC30A9

Genomic Location for PLCG1 Gene

Chromosome:
20
Start:
41,136,960 bp from pter
End:
41,196,801 bp from pter
Size:
59,842 bases
Orientation:
Plus strand

Genomic View for PLCG1 Gene

Genes around PLCG1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PLCG1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PLCG1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PLCG1 Gene

Proteins for PLCG1 Gene

  • Protein details for PLCG1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P19174-PLCG1_HUMAN
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
    Protein Accession:
    P19174
    Secondary Accessions:
    • B7ZLY7
    • B9EGH4
    • E1P5W4
    • Q2V575

    Protein attributes for PLCG1 Gene

    Size:
    1290 amino acids
    Molecular mass:
    148532 Da
    Cofactor:
    Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
    Quaternary structure:
    • Interacts with AGAP2 via its SH3 domain. Interacts (via SH2 domain) with RET. Interacts with FLT1 (tyrosine-phosphorylated) (By similarity). Interacts (via SH2 domain) with FGFR1, FGFR2, FGFR3 and FGFR4 (phosphorylated). Interacts with LAT (phosphorylated) upon TCR activation. Interacts (via SH3 domain) with the Pro-rich domain of TNK1. Associates with BLNK, VAV1, GRB2 and NCK1 in a B-cell antigen receptor-dependent fashion. Interacts with CBLB in activated T-cells; which inhibits phosphorylation. Interacts with SHB. Interacts (via SH3 domain) with the Arg/Gly-rich-flanked Pro-rich domains of KHDRBS1/SAM68. This interaction is selectively regulated by arginine methylation of KHDRBS1/SAM68. Interacts with INPP5D/SHIP1, THEMIS and CLNK (By similarity). Interacts with AXL, FLT4 and KIT. Interacts with RALGPS1. Interacts (via SH3 domain) with HEV ORF3 protein. Interacts (via the SH2 domains) with VIL1 (phosphorylated at C-terminus tyrosine phosphorylation sites). Interacts (via SH2 domain) with PDGFRA and PDGFRB (tyrosine phosphorylated). Interacts with PIP5K1C (By similarity). Interacts with NTRK1 and NTRK2 (phosphorylated upon ligand-binding). Interacts with SYK; activates PLCG1. Interacts with GRB2, LAT and THEMIS upon TCR activation in thymocytes (By similarity). Interacts with TESPA1; the association is increased with prolonged stimulation of the TCR and may facilitate the assembly of the LAT signalosome.

    Three dimensional structures from OCA and Proteopedia for PLCG1 Gene

    Alternative splice isoforms for PLCG1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PLCG1 Gene

Selected DME Specific Peptides for PLCG1 Gene

P19174:
  • MYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYY
  • SEYPVILS
  • VYEEDMFSD
  • GCRCIELDCWDGPDG
  • KQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEE
  • QLSRIYP
  • VLGARHLPK
  • DYTLSFWR
  • SSHNTYL
  • VALNFQT
  • ENGDLSPF
  • YHGHTLT
  • EIKEIRPGK

Post-translational modifications for PLCG1 Gene

  • Tyrosine phosphorylated in response to signaling via activated FLT3, KIT and PDGFRA (By similarity). Tyrosine phosphorylated by activated FGFR1, FGFR2, FGFR3 and FGFR4. Tyrosine phosphorylated by activated FLT1 and KDR. Tyrosine phosphorylated by activated PDGFRB. The receptor-mediated activation of PLCG1 involves its phosphorylation by tyrosine kinases, in response to ligation of a variety of growth factor receptors and immune system receptors. For instance, SYK phosphorylates and activates PLCG1 in response to ligation of the B-cell receptor. May be dephosphorylated by PTPRJ. Phosphorylated by ITK and TXK on Tyr-783 upon TCR activation in T-cells.
  • Ubiquitinated by CBLB in activated T-cells.
  • Ubiquitination at Lys178, Lys226, posLast=431431, Lys440, and posLast=941941
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for PLCG1 (PLCG1)
  • Cloud-Clone Corp. Antibodies for PLCG1

Assay Products

  • Cloud-Clone Corp Assay Kits for PLCG1

Domains & Families for PLCG1 Gene

Suggested Antigen Peptide Sequences for PLCG1 Gene

Graphical View of Domain Structure for InterPro Entry

P19174

UniProtKB/Swiss-Prot:

PLCG1_HUMAN :
  • The SH3 domain mediates interaction with CLNK (By similarity). The SH3 domain also mediates interaction with RALGPS1.
Domain:
  • The SH3 domain mediates interaction with CLNK (By similarity). The SH3 domain also mediates interaction with RALGPS1.
genes like me logo Genes that share domains with PLCG1: view

Function for PLCG1 Gene

Molecular function for PLCG1 Gene

GENATLAS Biochemistry:
phospholipase C,gamma 1 (subtype 148),phosphatidylinositol specific,involved in signal transduction,directly interacting with phosphorylated PTK2 to promote adhesion-dependent association of the two molecules and increase inositol-phosphate production (mouse fibroblasts)
UniProtKB/Swiss-Prot CatalyticActivity:
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H(2)O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activated by phosphorylation on tyrosine residues.
UniProtKB/Swiss-Prot Function:
Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, FGFR1, FGFR2, FGFR3 and FGFR4. Plays a role in actin reorganization and cell migration.

Enzyme Numbers (IUBMB) for PLCG1 Gene

Gene Ontology (GO) - Molecular Function for PLCG1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004435 phosphatidylinositol phospholipase C activity IEA,TAS --
GO:0004629 phospholipase C activity TAS --
GO:0004871 signal transducer activity IEA --
GO:0005057 signal transducer activity, downstream of receptor NAS 7681365
GO:0005168 neurotrophin TRKA receptor binding IPI 15488758
genes like me logo Genes that share ontologies with PLCG1: view
genes like me logo Genes that share phenotypes with PLCG1: view

Animal Models for PLCG1 Gene

MGI Knock Outs for PLCG1:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PLCG1 Gene

Localization for PLCG1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PLCG1 Gene

Cell projection, lamellipodium. Cell projection, ruffle. Note=Rapidly redistributed to ruffles and lamellipodia structures in response to epidermal growth factor (EGF) treatment.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PLCG1 gene
Compartment Confidence
plasma membrane 5
nucleus 5
cytosol 5
extracellular 2
cytoskeleton 2
endoplasmic reticulum 2
endosome 1

Gene Ontology (GO) - Cellular Components for PLCG1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001726 ruffle IDA,IEA 17229814
GO:0005622 intracellular IEA --
GO:0005737 cytoplasm IDA 15702972
GO:0005829 cytosol TAS --
GO:0005886 plasma membrane TAS --
genes like me logo Genes that share ontologies with PLCG1: view

Pathways & Interactions for PLCG1 Gene

SuperPathways for PLCG1 Gene

SuperPathway Contained pathways
1 RET signaling
2 Downstream signaling of activated FGFR2
3 IL-2 Pathway
4 Immune response Fc epsilon RI pathway
5 Inositol phosphate metabolism (KEGG)
genes like me logo Genes that share pathways with PLCG1: view

Pathways by source for PLCG1 Gene

SIGNOR curated interactions for PLCG1 Gene

Gene Ontology (GO) - Biological Process for PLCG1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000186 activation of MAPKK activity TAS --
GO:0001701 in utero embryonic development IEA --
GO:0006629 lipid metabolic process IEA --
GO:0007165 signal transduction TAS,IEA --
GO:0007173 epidermal growth factor receptor signaling pathway IMP 22454520
genes like me logo Genes that share ontologies with PLCG1: view

Drugs & Compounds for PLCG1 Gene

(46) Drugs for PLCG1 Gene - From: PharmGKB, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Acetaminophen Approved Pharma Cyclooxygenase inhibitor; may be selective for COX-3 1026
Aspirin Approved, Vet_approved Pharma Channel blocker 1152
Diclofenac Approved, Vet_approved Pharma Channel blocker 323
Water Approved Pharma 0
calcium Nutra 0

(427) Additional Compounds for PLCG1 Gene - From: HMDB, Novoseek, and Tocris