Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PLCB1 Gene

Aliases for PLCB1 Gene

  • Phospholipase C Beta 1 2 3 5
  • Phospholipase C, Beta 1 (Phosphoinositide-Specific) 2 3
  • Phospholipase C-I 3 4
  • EC 3.1.4.11 4 58
  • PLC-Beta-1 3 4
  • PLC-154 3 4
  • PLC-I 3 4
  • 1-Phosphatidylinositol 4,5-Bisphosphate Phosphodiesterase Beta-1 3
  • 1-Phosphatidyl-D-Myo-Inositol-4,5-Bisphosphate 3
  • Monophosphatidylinositol Phosphodiesterase 3
  • Phosphoinositide Phospholipase C-Beta-1 4
  • Triphosphoinositide Phosphodiesterase 3
  • Inositoltrisphosphohydrolase 3
  • Phospholipase C-Beta-1 4
  • Phosphoinositidase C 3
  • KIAA0581 4
  • PI-PLC 3
  • EIEE12 3
  • PLC154 3
  • PLCB1A 3
  • PLCB1B 3

External Ids for PLCB1 Gene

Previous GeneCards Identifiers for PLCB1 Gene

  • GC20P008101
  • GC20P008108

Summaries for PLCB1 Gene

Entrez Gene Summary for PLCB1 Gene

  • The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. This gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for PLCB1 Gene

PLCB1 (Phospholipase C Beta 1) is a Protein Coding gene. Diseases associated with PLCB1 include Epileptic Encephalopathy, Early Infantile, 12 and Malignant Migrating Partial Seizures Of Infancy. Among its related pathways are Calcium signaling pathway and Long-term potentiation. GO annotations related to this gene include calcium ion binding and enzyme binding. An important paralog of this gene is PLCB3.

UniProtKB/Swiss-Prot for PLCB1 Gene

  • The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.

Tocris Summary for PLCB1 Gene

  • Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. There are four major classes; phospholipase A, phospholipase B, phosphoinositide-specific phospholipase C and phospholipase D.

Gene Wiki entry for PLCB1 Gene

Additional gene information for PLCB1 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PLCB1 Gene

Genomics for PLCB1 Gene

Regulatory Elements for PLCB1 Gene

Enhancers for PLCB1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH20H008144 1.5 Ensembl ENCODE dbSUPER 7.1 +68.0 67983 1 FOXA2 ATF1 MLX ARID4B DMAP1 YY1 TCF12 SLC30A9 ZNF143 ATF7 PLCB1 GC20M008185 PHKBP1
GH20H008427 1 FANTOM5 Ensembl ENCODE 10.6 +350.7 350654 1 HLF NR2F2 PLCB1 TMX4 GC20P008366 GC20M008621
GH20H008154 1.4 Ensembl ENCODE dbSUPER 6.4 +78.9 78869 2 FOXA2 MLX SLC30A9 FOS NFIL3 SSRP1 MIER3 RCOR2 ETV4 KDM1A PLCB1 GC20M008185 PHKBP1
GH20H008150 0.9 Ensembl ENCODE dbSUPER 6.9 +74.2 74159 1 JUN NR2F2 PLCB1 GC20M008185 PHKBP1
GH20H008161 0.9 Ensembl ENCODE dbSUPER 6.5 +84.5 84507 0 JUND HLF PLCB1 GC20M008185 PHKBP1
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PLCB1 on UCSC Golden Path with GeneCards custom track

Genomic Location for PLCB1 Gene

Chromosome:
20
Start:
8,077,251 bp from pter
End:
8,968,360 bp from pter
Size:
891,110 bases
Orientation:
Plus strand

Genomic View for PLCB1 Gene

Genes around PLCB1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PLCB1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PLCB1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PLCB1 Gene

Proteins for PLCB1 Gene

  • Protein details for PLCB1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9NQ66-PLCB1_HUMAN
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
    Protein Accession:
    Q9NQ66
    Secondary Accessions:
    • D3DW12
    • D3DW13
    • O60325
    • Q17RQ6
    • Q5TFF7
    • Q5TGC9
    • Q8IV93
    • Q9BQW2
    • Q9H4H2
    • Q9H8H5
    • Q9NQ65
    • Q9NQH9
    • Q9NTH4
    • Q9UJP6
    • Q9UM26

    Protein attributes for PLCB1 Gene

    Size:
    1216 amino acids
    Molecular mass:
    138567 Da
    Cofactor:
    Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
    Quaternary structure:
    • Interacts with DGKQ.
    Miscellaneous:
    • The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.
    SequenceCaution:
    • Sequence=BAA25507.3; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=BAB14641.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};

    Alternative splice isoforms for PLCB1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PLCB1 Gene

Selected DME Specific Peptides for PLCB1 Gene

Q9NQ66:
  • ELEQEYQDKFKRLPLEILEFVQEAMKGK
  • KRVETAL
  • GCRCVELD
  • YVEVDMFGLPVDTRRK
  • FEMSSFVETK
  • EEGGKFIGHRI
  • KVVLPTLA
  • GHRILPV
  • EIRQQILDEKPKLQ
  • EQLTKSP
  • RVDSSNY
  • LCPRPEID
  • EFMRRPDK
  • KAYTKLKLQV
  • SSVEMYRQ
  • IVDGIVAN
  • VFKKVVLP
  • ITHGFTMTT
  • RIYPKGTR
  • QQAKMAEYCR
  • EFVEYNK
  • QLSRIYP
  • KKKSEPSSPDH
  • QRAKQLAAL
  • LKPEFMRR
  • ISGQFLS
  • SSHNTYL
  • VALNFQT
  • SKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKL
  • PLSHYFI
  • LSFENHVDS
  • DSSNYMPQ

Post-translational modifications for PLCB1 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Cloud-Clone Corp. Antibodies for PLCB1

Domains & Families for PLCB1 Gene

Gene Families for PLCB1 Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Plasma proteins
  • Potential drug targets
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

genes like me logo Genes that share domains with PLCB1: view

No data available for UniProtKB/Swiss-Prot for PLCB1 Gene

Function for PLCB1 Gene

Molecular function for PLCB1 Gene

GENATLAS Biochemistry:
phospholipase C,beta 1,phosphatidylinositol specific,involved in signal transduction
UniProtKB/Swiss-Prot CatalyticActivity:
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H(2)O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.
UniProtKB/Swiss-Prot Function:
The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.

Enzyme Numbers (IUBMB) for PLCB1 Gene

Phenotypes From GWAS Catalog for PLCB1 Gene

Gene Ontology (GO) - Molecular Function for PLCB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004435 phosphatidylinositol phospholipase C activity ISS,TAS --
GO:0004629 phospholipase C activity TAS --
GO:0004871 signal transducer activity IEA --
GO:0005096 GTPase activator activity IDA 1322796
GO:0005509 calcium ion binding IEA --
genes like me logo Genes that share ontologies with PLCB1: view
genes like me logo Genes that share phenotypes with PLCB1: view

Human Phenotype Ontology for PLCB1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for PLCB1 Gene

MGI Knock Outs for PLCB1:

Animal Model Products

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PLCB1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Transcription Factor Targets and HOMER Transcription for PLCB1 Gene

Localization for PLCB1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PLCB1 Gene

Nucleus membrane. Cytoplasm. Note=Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PLCB1 gene
Compartment Confidence
extracellular 5
nucleus 5
cytosol 5
plasma membrane 3
cytoskeleton 1
endoplasmic reticulum 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Plasma membrane (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PLCB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000790 nuclear chromatin ISS --
GO:0005634 nucleus IEA,NAS 10760467
GO:0005737 cytoplasm IEA,IDA 11118617
GO:0005829 cytosol TAS --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with PLCB1: view

Pathways & Interactions for PLCB1 Gene

genes like me logo Genes that share pathways with PLCB1: view

Pathways by source for PLCB1 Gene

SIGNOR curated interactions for PLCB1 Gene

Activates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for PLCB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000086 G2/M transition of mitotic cell cycle ISS --
GO:0006629 lipid metabolic process IEA --
GO:0007165 signal transduction IEA,NAS 11118617
GO:0007213 G-protein coupled acetylcholine receptor signaling pathway ISS --
GO:0007215 glutamate receptor signaling pathway ISS --
genes like me logo Genes that share ontologies with PLCB1: view

Drugs & Compounds for PLCB1 Gene

(26) Drugs for PLCB1 Gene - From: PharmGKB, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
calcium Nutra 0
Selective serotonin reuptake inhibitors Pharma 0

(412) Additional Compounds for PLCB1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
1-Phosphatidyl-D-myo-inositol
  • (3-Phosphatidyl)-1-D-inositol
  • 1,2-Diacyl-sn-glycero-3-phosphoinositol
  • 1-Phosphatidyl-1D-myo-inositol
  • 1-Phosphatidyl-myo-inositol
  • Phosphatidyl-1D-myo-inositol
Diglycerides Group A
  • 1,2-Dimyristoyl-rac-glycerol
  • DAG(14:0/14:0)
  • DAG(28:0)
  • DG(14:0/14:0)
  • DG(28:0)
Diglycerides Group B
  • 1-Palmitoleoyl-2-arachidonyl-sn-glycerol
  • DAG(16:1/20:0)
  • DAG(16:1n7/20:0)
  • DAG(16:1w7/20:0)
  • DAG(36:1)
Diglycerides Group C
  • 1-Myristoyl-3-behenoyl-sn-glycerol
  • 1-Tetradecanoyl-3-docosanoyl-sn-glycerol
  • DAG(14:0/0:0/22:0)
  • DAG(36:0)
  • DG(36:0)
Diglycerides Group D
  • 1,2-Didocosahexaenoyl-rac-glycerol
  • DAG(22:6/22:6)
  • DAG(22:6n3/22:6n3)
  • DAG(22:6w3/22:6w3)
  • DAG(44:12)

(2) Tocris Compounds for PLCB1 Gene

Compound Action Cas Number
o-3M3FBS Inactive analog of m-3M3FBS (Cat. No. 1941) 313981-55-4
U 73122 Phospholipase C inhibitor 112648-68-7
genes like me logo Genes that share compounds with PLCB1: view

Transcripts for PLCB1 Gene

Unigene Clusters for PLCB1 Gene

Phospholipase C, beta 1 (phosphoinositide-specific):
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PLCB1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for PLCB1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^ 22 ^ 23 ^ 24 ^
SP1: -
SP2: -
SP3:
SP4:

ExUns: 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31 ^ 32 ^ 33a · 33b ^ 34 ^ 35 ^ 36
SP1: -
SP2: - -
SP3:
SP4:

Relevant External Links for PLCB1 Gene

GeneLoc Exon Structure for
PLCB1
ECgene alternative splicing isoforms for
PLCB1

Expression for PLCB1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PLCB1 Gene

mRNA differential expression in normal tissues according to GTEx for PLCB1 Gene

This gene is overexpressed in Brain - Frontal Cortex (BA9) (x5.7), Brain - Putamen (basal ganglia) (x4.8), Brain - Caudate (basal ganglia) (x4.7), and Brain - Anterior cingulate cortex (BA24) (x4.2).

Protein differential expression in normal tissues from HIPED for PLCB1 Gene

This gene is overexpressed in Frontal cortex (30.2), Brain (20.1), and Fetal Brain (7.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PLCB1 Gene



Protein tissue co-expression partners for PLCB1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PLCB1 Gene:

PLCB1

SOURCE GeneReport for Unigene cluster for PLCB1 Gene:

Hs.431173

Evidence on tissue expression from TISSUES for PLCB1 Gene

  • Nervous system(4.8)
  • Muscle(2.3)
  • Kidney(2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for PLCB1 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • digestive
  • integumentary
  • nervous
  • respiratory
  • skeletal muscle
  • skeleton
Organs:
Head and neck:
  • brain
  • cerebellum
  • cranial nerve
  • eye
  • face
  • forehead
  • head
  • lip
  • mouth
  • nose
  • pharynx
  • skull
Thorax:
  • chest wall
  • diaphragm
  • esophagus
  • lung
  • rib
  • rib cage
Abdomen:
  • abdominal wall
  • intestine
  • large intestine
  • stomach
Pelvis:
  • pelvis
  • rectum
Limb:
  • digit
  • finger
  • foot
  • hand
  • lower limb
  • upper limb
General:
  • peripheral nerve
  • peripheral nervous system
  • skin
  • spinal column
  • spinal cord
  • vertebrae
genes like me logo Genes that share expression patterns with PLCB1: view

Primer Products

No data available for mRNA Expression by UniProt/SwissProt for PLCB1 Gene

Orthologs for PLCB1 Gene

This gene was present in the common ancestor of animals.

Orthologs for PLCB1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PLCB1 33 34
  • 99.63 (n)
dog
(Canis familiaris)
Mammalia PLCB1 33 34
  • 93.36 (n)
cow
(Bos Taurus)
Mammalia PLCB1 33 34
  • 91.58 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PLCB1 34
  • 91 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia PLCB1 34
  • 90 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Plcb1 33
  • 89.45 (n)
mouse
(Mus musculus)
Mammalia Plcb1 33 16 34
  • 89.14 (n)
chicken
(Gallus gallus)
Aves PLCB1 33 34
  • 82.19 (n)
lizard
(Anolis carolinensis)
Reptilia PLCB1 34
  • 86 (a)
OneToOne
zebrafish
(Danio rerio)
Actinopterygii PLCB1 (2 of 2) 34
  • 72 (a)
OneToMany
PLCB1 (1 of 2) 34
  • 64 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta Plc21C 33 34
  • 56.68 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP009115 33
  • 52.77 (n)
worm
(Caenorhabditis elegans)
Secernentea Y75B12B.6 35
  • 28 (a)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 46 (a)
OneToMany
Species where no ortholog for PLCB1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)

Evolution for PLCB1 Gene

ENSEMBL:
Gene Tree for PLCB1 (if available)
TreeFam:
Gene Tree for PLCB1 (if available)

Paralogs for PLCB1 Gene

Paralogs for PLCB1 Gene

(9) SIMAP similar genes for PLCB1 Gene using alignment to 5 proteins:

genes like me logo Genes that share paralogs with PLCB1: view

Variants for PLCB1 Gene

Sequence variations from dbSNP and Humsavar for PLCB1 Gene

SNP ID Clin Chr 20 pos Sequence Context AA Info Type
VAR_036547 A breast cancer sample
rs114229570 Likely benign 8,884,902(+) ACAAC(A/C)CAGCG downstream-variant-500B, utr-variant-3-prime
rs13042803 Likely benign 8,717,805(+) ACCTA(A/C/T)AGTGA nc-transcript-variant, reference, synonymous-codon
rs138442805 Likely benign 8,740,457(+) AACAA(C/T)TTAAC intron-variant
rs139859188 Likely benign 8,774,647(+) CAACA(A/G)CAGCA downstream-variant-500B, reference, synonymous-codon

Structural Variations from Database of Genomic Variants (DGV) for PLCB1 Gene

Variant ID Type Subtype PubMed ID
dgv240n21 CNV loss 19592680
dgv7457n54 CNV gain 21841781
dgv7458n54 CNV gain 21841781
dgv7459n54 CNV loss 21841781
esv1042376 CNV deletion 17803354
esv1209654 CNV insertion 17803354
esv2295237 CNV deletion 18987734
esv23038 CNV loss 19812545
esv2422203 CNV duplication 17116639
esv2569373 CNV deletion 19546169
esv2623512 CNV deletion 19546169
esv2656531 CNV deletion 23128226
esv2660358 CNV deletion 23128226
esv2665461 CNV deletion 23128226
esv2674984 CNV deletion 23128226
esv2677223 CNV deletion 23128226
esv2722153 CNV deletion 23290073
esv2722154 CNV deletion 23290073
esv2722155 CNV deletion 23290073
esv2722156 CNV deletion 23290073
esv2722157 CNV deletion 23290073
esv2722158 CNV deletion 23290073
esv2722159 CNV deletion 23290073
esv2742905 CNV deletion 23290073
esv2758779 CNV gain 17122850
esv3306355 CNV mobile element insertion 20981092
esv3306376 CNV mobile element insertion 20981092
esv3307215 CNV mobile element insertion 20981092
esv3307398 CNV mobile element insertion 20981092
esv3308099 CNV mobile element insertion 20981092
esv3322682 CNV insertion 20981092
esv3334543 CNV insertion 20981092
esv3352442 CNV insertion 20981092
esv3363440 CNV insertion 20981092
esv3425385 CNV insertion 20981092
esv3429493 CNV insertion 20981092
esv35097 CNV gain 17911159
esv3556804 CNV deletion 23714750
esv3556805 CNV deletion 23714750
esv3556806 CNV deletion 23714750
esv3575357 CNV gain 25503493
esv3575358 CNV gain 25503493
esv3584439 CNV loss 25503493
esv3584440 CNV loss 25503493
esv3645159 CNV gain 21293372
esv3645162 CNV loss 21293372
esv3645163 CNV loss 21293372
esv3645165 CNV gain 21293372
esv3645166 CNV loss 21293372
esv3645168 CNV loss 21293372
esv3645169 CNV loss 21293372
esv3645172 CNV loss 21293372
esv3645177 CNV loss 21293372
esv3645178 CNV loss 21293372
esv3893282 CNV loss 25118596
esv3893283 CNV loss 25118596
esv3893284 CNV gain 25118596
nsv1056621 CNV loss 25217958
nsv1057497 CNV loss 25217958
nsv1058042 CNV loss 25217958
nsv1058716 CNV gain 25217958
nsv1061601 CNV loss 25217958
nsv1067533 CNV loss 25217958
nsv1071321 CNV deletion 25765185
nsv1110936 OTHER inversion 24896259
nsv1118660 CNV duplication 24896259
nsv1123452 CNV deletion 24896259
nsv1124828 CNV duplication 24896259
nsv1131568 CNV deletion 24896259
nsv1142434 CNV deletion 24896259
nsv1142986 CNV tandem duplication 24896259
nsv178902 CNV deletion 16902084
nsv179312 CNV deletion 16902084
nsv179314 CNV insertion 16902084
nsv179322 CNV insertion 16902084
nsv179513 CNV deletion 16902084
nsv179883 CNV deletion 16902084
nsv3280 CNV insertion 18451855
nsv3281 CNV deletion 18451855
nsv3282 CNV deletion 18451855
nsv458863 CNV gain 19166990
nsv473630 CNV novel sequence insertion 20440878
nsv475970 CNV novel sequence insertion 20440878
nsv517649 CNV loss 19592680
nsv517930 CNV loss 19592680
nsv521272 CNV loss 19592680
nsv521502 CNV gain 19592680
nsv524662 CNV loss 19592680
nsv585384 CNV gain 21841781
nsv585392 CNV gain 21841781
nsv585393 CNV gain 21841781
nsv585394 CNV loss 21841781
nsv585396 CNV loss 21841781
nsv585397 CNV loss 21841781
nsv585398 CNV loss 21841781
nsv585404 CNV loss 21841781
nsv819177 CNV loss 19587683
nsv828685 CNV loss 20364138
nsv833916 CNV gain 17160897
nsv954267 CNV deletion 24416366
nsv954283 CNV deletion 24416366
nsv9782 CNV loss 18304495

Variation tolerance for PLCB1 Gene

Residual Variation Intolerance Score: 6.89% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.21; 52.25% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PLCB1 Gene

Human Gene Mutation Database (HGMD)
PLCB1
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PLCB1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PLCB1 Gene

Disorders for PLCB1 Gene

MalaCards: The human disease database

(5) MalaCards diseases for PLCB1 Gene - From: HGMD, OMIM, ClinVar, GeneTests, Orphanet, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
epileptic encephalopathy, early infantile, 12
  • early infantile epileptic encephalopathy 12
malignant migrating partial seizures of infancy
  • epileptic encephalopathy, early infantile, 14
west syndrome
  • epileptic encephalopathy, early infantile, 1
coronary artery aneurysm
  • coronary aneurysm
cholera
  • cholera - vibrio cholerae
- elite association - COSMIC cancer census association via MalaCards
Search PLCB1 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

PLCB1_HUMAN
  • Epileptic encephalopathy, early infantile, 12 (EIEE12) [MIM:613722]: A form of epilepsy characterized by frequent tonic seizures or spasms beginning in infancy with a specific EEG finding of suppression-burst patterns, characterized by high-voltage bursts alternating with almost flat suppression phases. Patients may progress to West syndrome, which is characterized by tonic spasms with clustering, arrest of psychomotor development, and hypsarrhythmia on EEG. {ECO:0000269 PubMed:20833646}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Relevant External Links for PLCB1

Genetic Association Database (GAD)
PLCB1
Human Genome Epidemiology (HuGE) Navigator
PLCB1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PLCB1
genes like me logo Genes that share disorders with PLCB1: view

No data available for Genatlas for PLCB1 Gene

Publications for PLCB1 Gene

  1. Cloning and characterization of the human phosphoinositide-specific phospholipase C-beta 1 (PLC beta 1). (PMID: 11118617) Caricasole A … Terstappen GC (Biochimica et biophysica acta 2000) 2 3 4 22 60
  2. Identification and chromosomal localisation by fluorescence in situ hybridisation of human gene of phosphoinositide-specific phospholipase C beta(1). (PMID: 10760467) Peruzzi D … Cocco L (Biochimica et biophysica acta 2000) 2 3 4 22 60
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 45 60
  4. Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment. (PMID: 20056178) Segat L … Crovella S (Vaccine 2010) 3 45 60
  5. PLC/CAMK IV-NF-kappaB involved in the receptor for advanced glycation end products mediated signaling pathway in human endothelial cells. (PMID: 20171262) You J … Lin JY (Molecular and cellular endocrinology 2010) 3 22 60

Products for PLCB1 Gene

Sources for PLCB1 Gene

Content
Loading form....