Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PLCB1 Gene

Aliases for PLCB1 Gene

  • Phospholipase C Beta 1 2 3 5
  • Phospholipase C, Beta 1 (Phosphoinositide-Specific) 2 3
  • Phospholipase C-I 3 4
  • EC 3.1.4.11 4 61
  • PLC-Beta-1 3 4
  • PLC-154 3 4
  • PLC-I 3 4
  • 1-Phosphatidylinositol 4,5-Bisphosphate Phosphodiesterase Beta-1 3
  • 1-Phosphatidyl-D-Myo-Inositol-4,5-Bisphosphate 3
  • Monophosphatidylinositol Phosphodiesterase 3
  • Phosphoinositide Phospholipase C-Beta-1 4
  • Triphosphoinositide Phosphodiesterase 3
  • Inositoltrisphosphohydrolase 3
  • Phospholipase C-Beta-1 4
  • Phosphoinositidase C 3
  • KIAA0581 4
  • PI-PLC 3
  • EIEE12 3
  • PLC154 3
  • PLCB1A 3
  • PLCB1B 3

External Ids for PLCB1 Gene

Previous GeneCards Identifiers for PLCB1 Gene

  • GC20P008101
  • GC20P008108

Summaries for PLCB1 Gene

Entrez Gene Summary for PLCB1 Gene

  • The protein encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. This gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

GeneCards Summary for PLCB1 Gene

PLCB1 (Phospholipase C Beta 1) is a Protein Coding gene. Diseases associated with PLCB1 include Epileptic Encephalopathy, Early Infantile, 12 and Malignant Migrating Partial Seizures Of Infancy. Among its related pathways are Signaling by GPCR and Presynaptic function of Kainate receptors. GO annotations related to this gene include calcium ion binding and enzyme binding. An important paralog of this gene is PLCB3.

UniProtKB/Swiss-Prot for PLCB1 Gene

  • The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.

Tocris Summary for PLCB1 Gene

  • Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. There are four major classes; phospholipase A, phospholipase B, phosphoinositide-specific phospholipase C and phospholipase D.

Gene Wiki entry for PLCB1 Gene

No data available for PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PLCB1 Gene

Genomics for PLCB1 Gene

Regulatory Elements for PLCB1 Gene

Enhancers for PLCB1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH20F008427 1 FANTOM5 Ensembl ENCODE 10.6 +351.1 351072 1.8 HLF IKZF1 TBX21 MAFK PLCB1 TMX4 GC20P008366 GC20M008621
GH20F008144 1.3 Ensembl ENCODE 7.1 +68.0 67954 1.6 ATF1 MLX ARID4B DMAP1 ZNF48 YY1 SLC30A9 ZNF143 FOS PAF1 PLCB1 GC20M008185 PHKBP1
GH20F008150 1.3 Ensembl ENCODE 6.9 +76.9 76858 7.0 MLX ARID4B SIN3A ZNF48 SLC30A9 GLIS2 FOS PAF1 MXD4 MIER2 PLCB1 GC20M008185 PHKBP1
GH20F008431 1.1 FANTOM5 Ensembl ENCODE 5 +355.5 355490 1.7 REST RAD21 SPI1 PLCB1 TMX4 GC20P008366 GC20M008621
GH20F008454 1.4 FANTOM5 Ensembl ENCODE 3.9 +377.4 377386 1.0 CTCF PKNOX1 JUN INSM2 SIN3A MAX RAD21 TEAD3 CTBP1 SMC3 PLCB1 GC20P008366 GC20M008621
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PLCB1 on UCSC Golden Path with GeneCards custom track

Genomic Location for PLCB1 Gene

Chromosome:
20
Start:
8,077,251 bp from pter
End:
8,968,360 bp from pter
Size:
891,110 bases
Orientation:
Plus strand

Genomic View for PLCB1 Gene

Genes around PLCB1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PLCB1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PLCB1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PLCB1 Gene

Proteins for PLCB1 Gene

  • Protein details for PLCB1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9NQ66-PLCB1_HUMAN
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
    Protein Accession:
    Q9NQ66
    Secondary Accessions:
    • D3DW12
    • D3DW13
    • O60325
    • Q17RQ6
    • Q5TFF7
    • Q5TGC9
    • Q8IV93
    • Q9BQW2
    • Q9H4H2
    • Q9H8H5
    • Q9NQ65
    • Q9NQH9
    • Q9NTH4
    • Q9UJP6
    • Q9UM26

    Protein attributes for PLCB1 Gene

    Size:
    1216 amino acids
    Molecular mass:
    138567 Da
    Cofactor:
    Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
    Quaternary structure:
    • Interacts with DGKQ.
    Miscellaneous:
    • The receptor-mediated activation of PLC-beta-1 is mediated by two G-protein alpha subunits, alpha-Q and alpha-11.
    SequenceCaution:
    • Sequence=BAA25507.3; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=BAB14641.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};

    Alternative splice isoforms for PLCB1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PLCB1 Gene

Selected DME Specific Peptides for PLCB1 Gene

Q9NQ66:
  • ELEQEYQDKFKRLPLEILEFVQEAMKGK
  • KRVETAL
  • GCRCVELD
  • YVEVDMFGLPVDTRRK
  • FEMSSFVETK
  • EEGGKFIGHRI
  • KVVLPTLA
  • GHRILPV
  • EIRQQILDEKPKLQ
  • EQLTKSP
  • RVDSSNY
  • LCPRPEID
  • EFMRRPDK
  • KAYTKLKLQV
  • SSVEMYRQ
  • IVDGIVAN
  • VFKKVVLP
  • ITHGFTMTT
  • RIYPKGTR
  • QQAKMAEYCR
  • EFVEYNK
  • QLSRIYP
  • KKKSEPSSPDH
  • QRAKQLAAL
  • LKPEFMRR
  • ISGQFLS
  • SSHNTYL
  • VALNFQT
  • SKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKL
  • PLSHYFI
  • LSFENHVDS
  • DSSNYMPQ

Post-translational modifications for PLCB1 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Cloud-Clone Corp. Antibodies for PLCB1

Domains & Families for PLCB1 Gene

Gene Families for PLCB1 Gene

Graphical View of Domain Structure for InterPro Entry

Q9NQ66

UniProtKB/Swiss-Prot:

PLCB1_HUMAN :
  • Contains 1 C2 domain.
Domain:
  • Contains 1 C2 domain.
  • Contains 1 PI-PLC X-box domain.
  • Contains 1 PI-PLC Y-box domain.
genes like me logo Genes that share domains with PLCB1: view

Function for PLCB1 Gene

Molecular function for PLCB1 Gene

GENATLAS Biochemistry:
phospholipase C,beta 1,phosphatidylinositol specific,involved in signal transduction
UniProtKB/Swiss-Prot CatalyticActivity:
1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H(2)O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.
UniProtKB/Swiss-Prot Function:
The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.

Enzyme Numbers (IUBMB) for PLCB1 Gene

Gene Ontology (GO) - Molecular Function for PLCB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004435 phosphatidylinositol phospholipase C activity IEA,TAS --
GO:0004871 signal transducer activity IEA --
GO:0005096 GTPase activator activity IDA 1322796
GO:0005509 calcium ion binding IEA --
GO:0005515 protein binding IPI 25416956
genes like me logo Genes that share ontologies with PLCB1: view
genes like me logo Genes that share phenotypes with PLCB1: view

Human Phenotype Ontology for PLCB1 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for PLCB1 Gene

MGI Knock Outs for PLCB1:

Animal Model Products

Inhibitory RNA Products

Flow Cytometry Products

No data available for Transcription Factor Targets and HOMER Transcription for PLCB1 Gene

Localization for PLCB1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for PLCB1 Gene

Nucleus membrane. Cytoplasm. Note=Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PLCB1 gene
Compartment Confidence
extracellular 5
nucleus 5
cytosol 5
plasma membrane 3
cytoskeleton 1
endoplasmic reticulum 1

Gene Ontology (GO) - Cellular Components for PLCB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000790 nuclear chromatin ISS --
GO:0005634 nucleus IEA,NAS 10760467
GO:0005737 cytoplasm IEA,IDA 11118617
GO:0005829 cytosol TAS --
GO:0016020 membrane IEA --
genes like me logo Genes that share ontologies with PLCB1: view

Pathways & Interactions for PLCB1 Gene

genes like me logo Genes that share pathways with PLCB1: view

Pathways by source for PLCB1 Gene

SIGNOR curated interactions for PLCB1 Gene

Activates:
Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for PLCB1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000086 G2/M transition of mitotic cell cycle ISS --
GO:0006629 lipid metabolic process IEA --
GO:0007165 signal transduction IEA,NAS 11118617
GO:0007213 G-protein coupled acetylcholine receptor signaling pathway ISS --
GO:0007215 glutamate receptor signaling pathway ISS --
genes like me logo Genes that share ontologies with PLCB1: view

Drugs & Compounds for PLCB1 Gene

(26) Drugs for PLCB1 Gene - From: PharmGKB, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
calcium Nutra 0
Selective serotonin reuptake inhibitors Pharma 0

(412) Additional Compounds for PLCB1 Gene - From: HMDB, Novoseek, and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
1-Phosphatidyl-D-myo-inositol
  • (3-Phosphatidyl)-1-D-inositol
  • 1,2-Diacyl-sn-glycero-3-phosphoinositol
  • 1-Phosphatidyl-1D-myo-inositol
  • 1-Phosphatidyl-myo-inositol
  • Phosphatidyl-1D-myo-inositol
Diglycerides Group A
  • 1,2-Dimyristoyl-rac-glycerol
  • DAG(14:0/14:0)
  • DAG(28:0)
  • DG(14:0/14:0)
  • DG(28:0)
Diglycerides Group B
  • 1-Palmitoleoyl-2-arachidonyl-sn-glycerol
  • DAG(16:1/20:0)
  • DAG(16:1n7/20:0)
  • DAG(16:1w7/20:0)
  • DAG(36:1)
Diglycerides Group C
  • 1-Myristoyl-3-stearoyl-sn-glycerol
  • 1-Tetradecanoyl-3-octadecanoyl-sn-glycerol
  • DAG(14:0/0:0/18:0)
  • DAG(32:0)
  • DG(32:0)
Diglycerides Group D
  • 1,2-Didocosahexaenoyl-rac-glycerol
  • DAG(22:6/22:6)
  • DAG(22:6n3/22:6n3)
  • DAG(22:6w3/22:6w3)
  • DAG(44:12)

(2) Tocris Compounds for PLCB1 Gene

Compound Action Cas Number
o-3M3FBS Inactive analog of m-3M3FBS (Cat. No. 1941) 313981-55-4
U 73122 Phospholipase C inhibitor 112648-68-7
genes like me logo Genes that share compounds with PLCB1: view

Transcripts for PLCB1 Gene

Unigene Clusters for PLCB1 Gene

Phospholipase C, beta 1 (phosphoinositide-specific):
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for PLCB1 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19 ^ 20 ^ 21 ^ 22 ^ 23 ^ 24 ^
SP1: -
SP2: -
SP3:
SP4:

ExUns: 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31 ^ 32 ^ 33a · 33b ^ 34 ^ 35 ^ 36
SP1: -
SP2: - -
SP3:
SP4:

Relevant External Links for PLCB1 Gene

GeneLoc Exon Structure for
PLCB1
ECgene alternative splicing isoforms for
PLCB1

Expression for PLCB1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PLCB1 Gene

mRNA differential expression in normal tissues according to GTEx for PLCB1 Gene

This gene is overexpressed in Brain - Frontal Cortex (BA9) (x5.7), Brain - Putamen (basal ganglia) (x4.8), Brain - Caudate (basal ganglia) (x4.7), and Brain - Anterior cingulate cortex (BA24) (x4.2).

Protein differential expression in normal tissues from HIPED for PLCB1 Gene

This gene is overexpressed in Frontal cortex (30.2), Brain (20.1), and Fetal Brain (7.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PLCB1 Gene



Protein tissue co-expression partners for PLCB1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PLCB1 Gene:

PLCB1

SOURCE GeneReport for Unigene cluster for PLCB1 Gene:

Hs.431173
genes like me logo Genes that share expression patterns with PLCB1: view

Primer Products

No data available for mRNA Expression by UniProt/SwissProt for PLCB1 Gene

Orthologs for PLCB1 Gene

This gene was present in the common ancestor of animals.

Orthologs for PLCB1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PLCB1 34 35
  • 99.63 (n)
dog
(Canis familiaris)
Mammalia PLCB1 34 35
  • 93.36 (n)
cow
(Bos Taurus)
Mammalia PLCB1 34 35
  • 91.58 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PLCB1 35
  • 91 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia PLCB1 35
  • 90 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Plcb1 34
  • 89.45 (n)
mouse
(Mus musculus)
Mammalia Plcb1 34 16 35
  • 89.14 (n)
chicken
(Gallus gallus)
Aves PLCB1 34 35
  • 82.19 (n)
lizard
(Anolis carolinensis)
Reptilia PLCB1 35
  • 86 (a)
OneToOne
zebrafish
(Danio rerio)
Actinopterygii PLCB1 (2 of 2) 35
  • 72 (a)
OneToMany
PLCB1 (1 of 2) 35
  • 64 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta Plc21C 34 35
  • 56.68 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta