Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PIP4K2A Gene

Aliases for PIP4K2A Gene

  • Phosphatidylinositol-5-Phosphate 4-Kinase Type 2 Alpha 2 3 5
  • Phosphatidylinositol-4-Phosphate 5-Kinase, Type II, Alpha 2 3
  • Phosphatidylinositol 5-Phosphate 4-Kinase Type II Alpha 3 4
  • 1-Phosphatidylinositol 5-Phosphate 4-Kinase 2-Alpha 3 4
  • PtdIns(5)P-4-Kinase Isoform 2-Alpha 3 4
  • Diphosphoinositide Kinase 2-Alpha 3 4
  • PtdIns(4)P-5-Kinase C Isoform 3 4
  • PI(5)P 4-Kinase Type II Alpha 3 4
  • PtdIns(4)P-5-Kinase B Isoform 3 4
  • PIP4KII-Alpha 3 4
  • EC 2.7.1.149 4 61
  • PIP5KIII 3 4
  • PIP5K2A 3 4
  • Type II Phosphatidylinositol-4-Phosphate 5-Kinase 53 K Isoform 3
  • Phosphatidylinositol-5-Phosphate 4-Kinase, Type II, Alpha 2
  • Phosphatidylinositol 5-Phosphate 4-Kinase Type-2 Alpha 3
  • 1-Phosphatidylinositol-4-Phosphate-5-Kinase 3
  • 1-Phosphatidylinositol-4-Phosphate Kinase 3
  • PIP5KII-Alpha 3
  • PIP5KIIalpha 3
  • PIP5KIIA 3
  • EC 2.7.1 61
  • PI5P4KA 3
  • PIP5K2 4
  • PIPK 3

External Ids for PIP4K2A Gene

Previous HGNC Symbols for PIP4K2A Gene

  • PIP5K2A

Previous GeneCards Identifiers for PIP4K2A Gene

  • GC10M022866
  • GC10M022823

Summaries for PIP4K2A Gene

Entrez Gene Summary for PIP4K2A Gene

  • Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility. The protein encoded by this gene is one of a family of enzymes capable of catalyzing the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. The amino acid sequence of this enzyme does not show homology to other kinases, but the recombinant protein does exhibit kinase activity. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family. [provided by RefSeq, Jul 2008]

GeneCards Summary for PIP4K2A Gene

PIP4K2A (Phosphatidylinositol-5-Phosphate 4-Kinase Type 2 Alpha) is a Protein Coding gene. Diseases associated with PIP4K2A include Leukemia, Acute Lymphoblastic 3 and Schizophrenia. Among its related pathways are RET signaling and Metabolism. GO annotations related to this gene include phosphatidylinositol phosphate kinase activity and 1-phosphatidylinositol-5-phosphate 4-kinase activity. An important paralog of this gene is PIP4K2B.

UniProtKB/Swiss-Prot for PIP4K2A Gene

  • Catalyzes the phosphorylation of phosphatidylinositol 5-phosphate (PtdIns5P) on the fourth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). May exert its function by regulating the levels of PtdIns5P, which functions in the cytosol by increasing AKT activity and in the nucleus signals through ING2. May regulate the pool of cytosolic PtdIns5P in response to the activation of tyrosine phosphorylation. May negatively regulate insulin-stimulated glucose uptake by lowering the levels of PtdIns5P. May be involved in thrombopoiesis, and the terminal maturation of megakaryocytes and regulation of their size.

Gene Wiki entry for PIP4K2A Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PIP4K2A Gene

Genomics for PIP4K2A Gene

Regulatory Elements for PIP4K2A Gene

Enhancers for PIP4K2A Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH10F022596 1.4 FANTOM5 Ensembl ENCODE 20.8 +97.2 97197 42.3 CREB3L1 ZFP64 FEZF1 ZNF143 ZNF263 SP3 TBX21 MEF2D ZNF610 ZNF585B PIP4K2A RPL31P45 ENSG00000260205 ENSG00000261671 DNAJC1 OTUD1 BMI1 MSRB2 COMMD3 TRP-GGG1-1
GH10F022670 1.1 Ensembl ENCODE 20.2 +35.6 35634 16.3 HDGF PKNOX1 ARNT CREB3L1 MLX WRNIP1 ARID4B SIN3A FEZF1 CBX5 PIP4K2A COMMD3 ENSG00000279819 TRP-GGG1-1
GH10F022641 0.9 Ensembl ENCODE 20 +63.3 63260 19.8 HDGF PKNOX1 WRNIP1 ZNF133 FEZF1 ZNF121 GATA2 FOS ZNF263 JUNB PIP4K2A COMMD3 ENSG00000279819 TRP-GGG1-1
GH10F022689 1.2 VISTA Ensembl ENCODE 13 +22.5 22506 6.0 ATF1 FEZF1 ZNF121 GLIS2 ZNF302 GATA2 FOS JUNB ZNF488 TSHZ1 PIP4K2A ENSG00000279819 TRP-GGG1-1
GH10F022688 0.2 Ensembl 12.9 +25.9 25874 0.6 PIP4K2A ENSG00000279819 TRP-GGG1-1
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around PIP4K2A on UCSC Golden Path with GeneCards custom track

Promoters for PIP4K2A Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000351902 974 3600 ARNT CREB3L1 WRNIP1 FEZF1 YY1 GLIS2 ZNF207 KLF7 ZNF263 SP3

Genomic Location for PIP4K2A Gene

Chromosome:
10
Start:
22,534,837 bp from pter
End:
22,714,574 bp from pter
Size:
179,738 bases
Orientation:
Minus strand

Genomic View for PIP4K2A Gene

Genes around PIP4K2A on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PIP4K2A Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PIP4K2A Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PIP4K2A Gene

Proteins for PIP4K2A Gene

  • Protein details for PIP4K2A Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P48426-PI42A_HUMAN
    Recommended name:
    Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
    Protein Accession:
    P48426
    Secondary Accessions:
    • B0YJ66
    • B4DGX2
    • D3DRV1
    • P53807
    • Q5VUX3

    Protein attributes for PIP4K2A Gene

    Size:
    406 amino acids
    Molecular mass:
    46225 Da
    Quaternary structure:
    • Homodimer (By similarity). Interacts with PIP4K2B. Interaction with PIP4K2B may regulate localization to the nucleus.

    Three dimensional structures from OCA and Proteopedia for PIP4K2A Gene

    Alternative splice isoforms for PIP4K2A Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PIP4K2A Gene

Selected DME Specific Peptides for PIP4K2A Gene

P48426:
  • NHLFNKEN
  • KTKKKHFV
  • VTRNVFSHRL
  • REASDKEK
  • ARSGARFHTSYD
  • KRFLDFI
  • VFRNLRERFGI
  • QKVKLFRAS
  • KEVYFMAIIDILT
  • YCPMVFRNLR
  • TLLPQFLGMYR
  • VKHGAGAEISTV
  • RKYDLKGS
  • FKFKEYCP
  • KDNDFIN
  • FLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVEC
  • DYSLLVG
  • SEDVAEMHNILKKYHQ

Post-translational modifications for PIP4K2A Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for PIP4K2A (PIP4K2A)

Domains & Families for PIP4K2A Gene

Graphical View of Domain Structure for InterPro Entry

P48426

UniProtKB/Swiss-Prot:

PI42A_HUMAN :
  • Contains 1 PIPK domain.
Domain:
  • Contains 1 PIPK domain.
genes like me logo Genes that share domains with PIP4K2A: view

No data available for Gene Families for PIP4K2A Gene

Function for PIP4K2A Gene

Molecular function for PIP4K2A Gene

UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=50 uM for phosphatidylinositol-5- phosphate {ECO:0000269 PubMed:20583997}; Vmax=466 pmol/min/ug enzyme {ECO:0000269 PubMed:20583997};
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + 1-phosphatidyl-1D-myo-inositol 5-phosphate = ADP + 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate.
UniProtKB/Swiss-Prot Function:
Catalyzes the phosphorylation of phosphatidylinositol 5-phosphate (PtdIns5P) on the fourth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). May exert its function by regulating the levels of PtdIns5P, which functions in the cytosol by increasing AKT activity and in the nucleus signals through ING2. May regulate the pool of cytosolic PtdIns5P in response to the activation of tyrosine phosphorylation. May negatively regulate insulin-stimulated glucose uptake by lowering the levels of PtdIns5P. May be involved in thrombopoiesis, and the terminal maturation of megakaryocytes and regulation of their size.

Enzyme Numbers (IUBMB) for PIP4K2A Gene

Gene Ontology (GO) - Molecular Function for PIP4K2A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
GO:0016307 phosphatidylinositol phosphate kinase activity IEA --
GO:0016308 1-phosphatidylinositol-4-phosphate 5-kinase activity NAS 7639683
GO:0016309 1-phosphatidylinositol-5-phosphate 4-kinase activity EXP 23758345
genes like me logo Genes that share ontologies with PIP4K2A: view
genes like me logo Genes that share phenotypes with PIP4K2A: view

Animal Models for PIP4K2A Gene

MGI Knock Outs for PIP4K2A:

Animal Model Products

  • Taconic Biosciences Mouse Models for PIP4K2A

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PIP4K2A Gene

Localization for PIP4K2A Gene

Subcellular locations from UniProtKB/Swiss-Prot for PIP4K2A Gene

Cell membrane. Nucleus. Cytoplasm. Note=May translocate from the cytosol to the cell membrane upon activation of tyrosine phosphorylation. May translocate from the inner to the outer segments of the rod photoreceptor cells in response to light (By similarity). Localization to the nucleus is modulated by the interaction with PIP4K2B. {ECO:0000250}.

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for PIP4K2A Gene COMPARTMENTS Subcellular localization image for PIP4K2A gene
Compartment Confidence
cytosol 5
plasma membrane 4
nucleus 3
vacuole 3
cytoskeleton 1

Gene Ontology (GO) - Cellular Components for PIP4K2A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005575 cellular_component ND --
GO:0005634 nucleus IEA --
GO:0005737 cytoplasm IEA --
GO:0005776 autophagosome IMP 25578879
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with PIP4K2A: view

Pathways & Interactions for PIP4K2A Gene

genes like me logo Genes that share pathways with PIP4K2A: view

SIGNOR curated interactions for PIP4K2A Gene

Is activated by:
Is inactivated by:

Gene Ontology (GO) - Biological Process for PIP4K2A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006661 phosphatidylinositol biosynthetic process TAS --
GO:0010506 regulation of autophagy IMP 25578879
GO:0014066 regulation of phosphatidylinositol 3-kinase signaling TAS --
GO:0016310 phosphorylation IEA --
GO:0035855 megakaryocyte development IEA --
genes like me logo Genes that share ontologies with PIP4K2A: view

Drugs & Compounds for PIP4K2A Gene

(1) Drugs for PIP4K2A Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0

(4) Additional Compounds for PIP4K2A Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
1-Phosphatidyl-D-myo-inositol
  • (3-Phosphatidyl)-1-D-inositol
  • 1,2-Diacyl-sn-glycero-3-phosphoinositol
  • 1-Phosphatidyl-1D-myo-inositol
  • 1-Phosphatidyl-myo-inositol
  • Phosphatidyl-1D-myo-inositol
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
genes like me logo Genes that share compounds with PIP4K2A: view

Transcripts for PIP4K2A Gene

Unigene Clusters for PIP4K2A Gene

Phosphatidylinositol-5-phosphate 4-kinase, type II, alpha:
Representative Sequences:

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for PIP4K2A Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9a · 9b ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15
SP1:
SP2: - - - - -
SP3:
SP4:

Relevant External Links for PIP4K2A Gene

GeneLoc Exon Structure for
PIP4K2A
ECgene alternative splicing isoforms for
PIP4K2A

Expression for PIP4K2A Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PIP4K2A Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for PIP4K2A Gene

This gene is overexpressed in Brain - Spinal cord (cervical c-1) (x6.6) and Brain - Substantia nigra (x4.8).

Protein differential expression in normal tissues from HIPED for PIP4K2A Gene

This gene is overexpressed in Peripheral blood mononuclear cells (11.7), Lymph node (9.8), and Platelet (7.7).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PIP4K2A Gene



Protein tissue co-expression partners for PIP4K2A Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PIP4K2A Gene:

PIP4K2A

SOURCE GeneReport for Unigene cluster for PIP4K2A Gene:

Hs.57079

mRNA Expression by UniProt/SwissProt for PIP4K2A Gene:

P48426-PI42A_HUMAN
Tissue specificity: Expressed ubiquitously, with high levels in the brain. Present in most tissues, except notably skeletal muscle and small intestine.
genes like me logo Genes that share expression patterns with PIP4K2A: view

Primer Products

Orthologs for PIP4K2A Gene

This gene was present in the common ancestor of animals.

Orthologs for PIP4K2A Gene

Organism Taxonomy Gene Similarity Type Details
dog
(Canis familiaris)
Mammalia -- 35
  • 100 (a)
OneToMany
PIP4K2A 34
  • 91.79 (n)
-- 35
  • 82 (a)
OneToMany
chimpanzee
(Pan troglodytes)
Mammalia PIP4K2A 34 35
  • 99.9 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PIP4K2A 35
  • 95 (a)
OneToOne
cow
(Bos Taurus)
Mammalia PIP4K2A 34 35
  • 92.59 (n)
mouse
(Mus musculus)
Mammalia Pip4k2a 34 16 35
  • 89.47 (n)
oppossum
(Monodelphis domestica)
Mammalia PIP4K2A 35
  • 89 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Pip4k2a 34
  • 87.93 (n)
chicken
(Gallus gallus)
Aves PIP4K2A 34 35
  • 84.53 (n)
lizard
(Anolis carolinensis)
Reptilia PIP4K2A 35
  • 93 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pip4k2b 34
  • 80.94 (n)
zebrafish
(Danio rerio)
Actinopterygii pip4k2aa 34 35
  • 76.84 (n)
pip4k2ab 35
  • 76 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta CG17471 35
  • 56 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea ppk-2 35
  • 52 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea CSA.7002 35
  • 55 (a)
OneToMany
Species where no ortholog for PIP4K2A was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PIP4K2A Gene

ENSEMBL:
Gene Tree for PIP4K2A (if available)
TreeFam:
Gene Tree for PIP4K2A (if available)

Paralogs for PIP4K2A Gene

Paralogs for PIP4K2A Gene

(6) SIMAP similar genes for PIP4K2A Gene using alignment to 7 proteins:

genes like me logo Genes that share paralogs with PIP4K2A: view

Variants for PIP4K2A Gene

Sequence variations from dbSNP and Humsavar for PIP4K2A Gene

SNP ID Clin Chr 10 pos Sequence Context AA Info Type
rs10047326 -- 22,550,534(+) CTTCC(A/C)TAAGG intron-variant
rs10159697 -- 22,677,807(+) ATAAT(C/T)TAGCA intron-variant
rs10159727 -- 22,565,877(+) ACTGC(A/G)GAGAT intron-variant
rs10159730 -- 22,566,018(+) tgccc(A/G)aaact intron-variant
rs10159847 -- 22,677,677(+) AATAA(A/G)TCCTC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for PIP4K2A Gene

Variant ID Type Subtype PubMed ID
esv2659118 CNV deletion 23128226
esv2661976 CNV deletion 23128226
esv2733984 CNV deletion 23290073
esv3334237 CNV insertion 20981092
esv3436167 CNV insertion 20981092
esv3622597 CNV loss 21293372
esv3622599 CNV loss 21293372
nsv1069032 CNV deletion 25765185
nsv1113259 CNV deletion 24896259
nsv1120079 OTHER inversion 24896259
nsv1126245 CNV deletion 24896259
nsv831809 CNV gain 17160897

Variation tolerance for PIP4K2A Gene

Residual Variation Intolerance Score: 14.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 7.46; 82.04% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PIP4K2A Gene

Human Gene Mutation Database (HGMD)
PIP4K2A
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PIP4K2A

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PIP4K2A Gene

Disorders for PIP4K2A Gene

MalaCards: The human disease database

(2) MalaCards diseases for PIP4K2A Gene - From: Orphanet, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
leukemia, acute lymphoblastic 3
  • burkitt lymphoma
schizophrenia
  • schizophrenia 12
- elite association - COSMIC cancer census association via MalaCards

Relevant External Links for PIP4K2A

Genetic Association Database (GAD)
PIP4K2A
Human Genome Epidemiology (HuGE) Navigator
PIP4K2A
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PIP4K2A
genes like me logo Genes that share disorders with PIP4K2A: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PIP4K2A Gene

Publications for PIP4K2A Gene

  1. Association analysis of the PIP4K2A gene on chromosome 10p12 and schizophrenia in the Irish study of high density schizophrenia families (ISHDSF) and the Irish case-control study of schizophrenia (ICCSS). (PMID: 19475563) Thiselton D.L. … Riley B.P. (Am. J. Med. Genet. B Neuropsychiatr. Genet. 2010) 3 22 46 64
  2. A new pathway for synthesis of phosphatidylinositol-4,5- bisphosphate. (PMID: 9367159) Rameh L.E. … Cantley L.C. (Nature 1997) 2 3 4 64
  3. The sequence of phosphatidylinositol-4-phosphate 5-kinase defines a novel family of lipid kinases. (PMID: 7852364) Boronenkov I.V. … Anderson R.A. (J. Biol. Chem. 1995) 2 3 4 64
  4. Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up. (PMID: 21041608) van Winkel R. (Arch. Gen. Psychiatry 2011) 3 46 64
  5. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64

Products for PIP4K2A Gene

Sources for PIP4K2A Gene

Content
Loading form....