Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PI4KB Gene

Aliases for PI4KB Gene

  • Phosphatidylinositol 4-Kinase Beta 2 3 5
  • Phosphatidylinositol 4-Kinase, Catalytic, Beta 2 3
  • PtdIns 4-Kinase Beta 3 4
  • EC 2.7.1.67 4 61
  • PI4K-BETA 3 4
  • PI4KBETA 3 4
  • PIK4CB 3 4
  • PI4K92 3 4
  • NPIK 3 4
  • Phosphatidylinositol 4-Kinase, Wortmannin-Sensitive 3
  • Type III Phosphatidylinositol 4-Kinase Beta 3
  • PI4KIIIBETA 3
  • EC 2.7.1 61

External Ids for PI4KB Gene

Previous HGNC Symbols for PI4KB Gene

  • PIK4CB

Previous GeneCards Identifiers for PI4KB Gene

  • GC01M149532
  • GC01M151264
  • GC01M122642

Summaries for PI4KB Gene

GeneCards Summary for PI4KB Gene

PI4KB (Phosphatidylinositol 4-Kinase Beta) is a Protein Coding gene. Among its related pathways are Metabolism and PI Metabolism. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and 1-phosphatidylinositol 4-kinase activity.

UniProtKB/Swiss-Prot for PI4KB Gene

  • Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking (By similarity).

Gene Wiki entry for PI4KB Gene

No data available for Entrez Gene Summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PI4KB Gene

Genomics for PI4KB Gene

Regulatory Elements for PI4KB Gene

Enhancers for PI4KB Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01F151276 1.3 FANTOM5 Ensembl ENCODE 4.9 +50.1 50115 2.8 PKNOX1 ESRRA JUN GATA3 EED ETV6 CREM MTA2 NR2F1 CEBPB PSMD4 BNIPL PI4KB CDC42SE1 ZNF687 TNFAIP8L2 RFX5 FAM63A
GH01F151308 1.8 FANTOM5 Ensembl ENCODE 3 +15.8 15779 6.1 CREB3L1 ZFP64 FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 SP3 NFYC GABPB2 SETDB1 MRPL9 GOLPH3L ZNF687 PRPF3 ADAMTSL4 RFX5 VPS72 UBE2D3P3
GH01F150969 1.6 FANTOM5 ENCODE 2.1 +352.8 352758 10.6 HDGF PKNOX1 ARNT MLX ZFP64 ARID4B SIN3A DMAP1 ZNF2 YY1 HORMAD1 ANXA9 GOLPH3L ARNT MCL1 GABPB2 MRPL9 CDC42SE1 ZNF687 CTSS
GH01F151479 0.2 ENCODE 9.8 -151.9 -151939 1.0 CGN ENSG00000252840 TUFT1 MIR554 RPS10P6 RNU6-1062P PSMB4 ENSG00000232536 MRPL9 OAZ3
GH01F151324 1.1 ENCODE 0.8 +1.0 968 4.2 HDGF ATF1 ARNT WRNIP1 SIN3A YBX1 DMAP1 ZNF2 YY1 ZNF121 GABPB2 MRPL9 LYSMD1 HRNR CTSS PI4KB RN7SL444P
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PI4KB on UCSC Golden Path with GeneCards custom track

Promoters for PI4KB Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000544887 415 2601 HDGF ARNT WRNIP1 SIN3A YBX1 DMAP1 ZNF2 YY1 ZNF121 ZNF302

Genomic Location for PI4KB Gene

Chromosome:
1
Start:
151,291,797 bp from pter
End:
151,327,715 bp from pter
Size:
35,919 bases
Orientation:
Minus strand

Genomic View for PI4KB Gene

Genes around PI4KB on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PI4KB Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PI4KB Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PI4KB Gene

Proteins for PI4KB Gene

  • Protein details for PI4KB Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UBF8-PI4KB_HUMAN
    Recommended name:
    Phosphatidylinositol 4-kinase beta
    Protein Accession:
    Q9UBF8
    Secondary Accessions:
    • B4DGI2
    • O15096
    • P78405
    • Q5VWB9
    • Q5VWC0
    • Q5VWC1
    • Q9BWR6

    Protein attributes for PI4KB Gene

    Size:
    816 amino acids
    Molecular mass:
    91379 Da
    Quaternary structure:
    • Interacts with ARF1 and ARF3 in the Golgi complex, but not with ARF4, ARF5 or ARF6 (PubMed:17555535). Interacts with NCS1/FREQ in a calcium-independent manner. Interacts with CALN1/CABP8 and CALN2/CABP7; in a calcium-dependent manner; this interaction competes with NCS1/FREQ binding (By similarity). Interacts with ACBD3. Interacts with YWHAB, YWHAE, YWHAG, YWHAH, YWHAQ, YWHAZ and SFN (PubMed:23572552).
    SequenceCaution:
    • Sequence=BAA21661.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=CAH70326.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=EAW53450.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for PI4KB Gene

    Alternative splice isoforms for PI4KB Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PI4KB Gene

Selected DME Specific Peptides for PI4KB Gene

Q9UBF8:
  • FDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECEN
  • DSEIRCL
  • LSPSKRTHQRSKSDAT
  • LKRTASNPKVE
  • ERVPLWI
  • FIAAGDIRRRLSEQLAHTPT
  • EFVDVMGGL
  • RQNNSAKQSWLLRLFESKLFDISMA
  • IRSTRSVENLP
  • GHIIHIDFGF
  • EKVRRIREGSPYGH
  • PLELVNGDGVD
  • IGKRLATLPTKEQKTQRLISELSLLNHKLPARVWL
  • REFIKSLM
  • QVLKQLQSIWE
  • VEPAPLKP
  • KDRHNGN
  • GDMFNYYKMLMLQGLIAARKHMD
  • EIRCLDDPP
  • TVPNYDNDDEAWSVDDIGELQVELPE
  • GTAKGARR
  • SISLSSNLKRT
  • RCRQSINFSLQCA
  • DSGMIEPVVNAVSIHQVKKQSQL
  • VEIMQQGSQLPCFHGSSTIRNLKERFHM
  • KACQEVL
  • HTNSCDNISQFSVDSITSQESK
  • PNWRLLSVIVKCGDDLRQELLA
  • YFLQEHGS
  • AQRNFVQSCA

Post-translational modifications for PI4KB Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for PI4KB Gene

Gene Families for PI4KB Gene

Graphical View of Domain Structure for InterPro Entry

Q9UBF8

UniProtKB/Swiss-Prot:

PI4KB_HUMAN :
  • Contains 1 PI3K/PI4K domain.
  • Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.
Domain:
  • Contains 1 PI3K/PI4K domain.
  • Contains 1 PIK helical domain.
Family:
  • Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.
genes like me logo Genes that share domains with PI4KB: view

Function for PI4KB Gene

Molecular function for PI4KB Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by wortmannin. Increased kinase activity upon interaction with NCS1/FREQ (By similarity).
UniProtKB/Swiss-Prot Function:
Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking (By similarity).

Enzyme Numbers (IUBMB) for PI4KB Gene

Gene Ontology (GO) - Molecular Function for PI4KB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004430 1-phosphatidylinositol 4-kinase activity TAS --
GO:0005515 protein binding IPI 17088255
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with PI4KB: view
genes like me logo Genes that share phenotypes with PI4KB: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PI4KB

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PI4KB Gene

Localization for PI4KB Gene

Subcellular locations from UniProtKB/Swiss-Prot for PI4KB Gene

Endomembrane system. Mitochondrion outer membrane; Peripheral membrane protein. Rough endoplasmic reticulum membrane; Peripheral membrane protein. Golgi apparatus. Cytoplasm, perinuclear region. Note=Found in the outer membrane of mitochondria and membranes of the rough endoplasmic reticulum. Recruited to the Golgi complex by the small GTPase ARF to stimulate the synthesis of phosphatidylinositol 4,5-bisphosphate (PIP2) on the Golgi complex.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PI4KB gene
Compartment Confidence
mitochondrion 5
endoplasmic reticulum 5
cytosol 5
golgi apparatus 5
endosome 5
nucleus 2
plasma membrane 1
peroxisome 1
lysosome 1

Gene Ontology (GO) - Cellular Components for PI4KB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane TAS --
GO:0005622 intracellular IEA --
GO:0005737 cytoplasm TAS 9584208
GO:0005739 mitochondrion IEA --
GO:0005741 mitochondrial outer membrane IEA --
genes like me logo Genes that share ontologies with PI4KB: view

Pathways & Interactions for PI4KB Gene

genes like me logo Genes that share pathways with PI4KB: view

SIGNOR curated interactions for PI4KB Gene

Is activated by:

Gene Ontology (GO) - Biological Process for PI4KB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006661 phosphatidylinositol biosynthetic process TAS --
GO:0006898 receptor-mediated endocytosis TAS 9584208
GO:0007165 signal transduction TAS 9020160
GO:0016310 phosphorylation IEA --
GO:0046854 phosphatidylinositol phosphorylation IEA --
genes like me logo Genes that share ontologies with PI4KB: view

Drugs & Compounds for PI4KB Gene

(3) Drugs for PI4KB Gene - From: ApexBio, DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
PIK-93 Pharma PI3Kγ/PI4KIIIβ/PI3Kα inhibitor 0
Wortmannin Pharma PI3K inhibitor,selective and irreversible 0

(3) Additional Compounds for PI4KB Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0

(1) ApexBio Compounds for PI4KB Gene

Compound Action Cas Number
PIK-93 PI3Kγ/PI4KIIIβ/PI3Kα inhibitor 593960-11-3
genes like me logo Genes that share compounds with PI4KB: view

Transcripts for PI4KB Gene

Unigene Clusters for PI4KB Gene

Phosphatidylinositol 4-kinase, catalytic, beta:
Representative Sequences:

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for PI4KB Gene

ExUns: 1a · 1b · 1c · 1d ^ 2a · 2b · 2c · 2d ^ 3 ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7 ^ 8a · 8b · 8c ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12a · 12b ^ 13a ·
SP1: - - - - - - -
SP2: - - -
SP3: - - -
SP4: - - - - - - - -
SP5:
SP6:
SP7: - - - - - - - - - -
SP8: - - - - - - -
SP9: -
SP10: - - - - - -
SP11: - - - -
SP12:
SP13:
SP14:

ExUns: 13b · 13c ^ 14a · 14b · 14c ^ 15 ^ 16a · 16b · 16c · 16d
SP1: - -
SP2: - -
SP3: - -
SP4: - -
SP5: -
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12: - - -
SP13:
SP14:

Relevant External Links for PI4KB Gene

GeneLoc Exon Structure for
PI4KB
ECgene alternative splicing isoforms for
PI4KB

Expression for PI4KB Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PI4KB Gene

Protein differential expression in normal tissues from HIPED for PI4KB Gene

This gene is overexpressed in Frontal cortex (13.7), CD8 Tcells (9.2), Lymph node (7.4), and Retina (7.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PI4KB Gene



NURSA nuclear receptor signaling pathways regulating expression of PI4KB Gene:

PI4KB

SOURCE GeneReport for Unigene cluster for PI4KB Gene:

Hs.632465

mRNA Expression by UniProt/SwissProt for PI4KB Gene:

Q9UBF8-PI4KB_HUMAN
Tissue specificity: Widely expressed with highest levels in heart, skeletal muscle, pancreas, testis and ovary. Weakly expressed in liver.
genes like me logo Genes that share expression patterns with PI4KB: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Protein tissue co-expression partners for PI4KB Gene

Orthologs for PI4KB Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PI4KB Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PI4KB 34 35
  • 99.64 (n)
oppossum
(Monodelphis domestica)
Mammalia PI4KB 35
  • 94 (a)
OneToOne
cow
(Bos Taurus)
Mammalia PI4KB 34 35
  • 93.47 (n)
dog
(Canis familiaris)
Mammalia PI4KB 34 35
  • 93.16 (n)
mouse
(Mus musculus)
Mammalia Pi4kb 34 16 35
  • 92.59 (n)
rat
(Rattus norvegicus)
Mammalia Pi4kb 34
  • 92.57 (n)
chicken
(Gallus gallus)
Aves PI4KB 34 35
  • 80.27 (n)
lizard
(Anolis carolinensis)
Reptilia PI4KB 35
  • 82 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pi4kb 34
  • 77.96 (n)
zebrafish
(Danio rerio)
Actinopterygii pi4kb 34 35
  • 75.92 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.9571 34
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP007512 34
  • 59.17 (n)
fruit fly
(Drosophila melanogaster)
Insecta fwd 34 35
  • 53.45 (n)
worm
(Caenorhabditis elegans)
Secernentea pifk-1 34 35
  • 48.04 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PIK1 35 37
  • 23 (a)
OneToOne
sea squirt
(Ciona savignyi)
Ascidiacea CSA.2331 35
  • 56 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.5032 34
Species where no ortholog for PI4KB was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • platypus (Ornithorhynchus anatinus)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PI4KB Gene

ENSEMBL:
Gene Tree for PI4KB (if available)
TreeFam:
Gene Tree for PI4KB (if available)

Paralogs for PI4KB Gene

genes like me logo Genes that share paralogs with PI4KB: view

No data available for Paralogs for PI4KB Gene

Variants for PI4KB Gene

Sequence variations from dbSNP and Humsavar for PI4KB Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs1056847 -- 151,315,696(-) CCTGA(C/T)ACAGG intron-variant, reference, synonymous-codon
rs10788803 -- 151,291,306(+) CATTA(A/G)TATTT downstream-variant-500B, utr-variant-3-prime
rs10888409 -- 151,299,306(+) AGTAG(A/C)AAGCC intron-variant
rs10888410 -- 151,299,975(+) TAAGT(C/T)TGAAT intron-variant
rs10888411 -- 151,301,408(+) TTTTT(A/T)TTTTT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for PI4KB Gene

Variant ID Type Subtype PubMed ID
nsv831581 CNV loss 17160897
nsv522840 CNV gain 19592680
nsv2821 CNV insertion 18451855
esv34461 CNV gain 17911159
esv2717851 CNV deletion 23290073
esv25158 CNV gain 19812545
dgv2n68 CNV loss 17160897

Variation tolerance for PI4KB Gene

Residual Variation Intolerance Score: 4.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.71; 32.54% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PI4KB Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PI4KB

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PI4KB Gene

Disorders for PI4KB Gene

Relevant External Links for PI4KB

Genetic Association Database (GAD)
PI4KB
Human Genome Epidemiology (HuGE) Navigator
PI4KB
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PI4KB

No disorders were found for PI4KB Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PI4KB Gene

Publications for PI4KB Gene

  1. Cloning and characterization of a wortmannin-sensitive human phosphatidylinositol 4-kinase. (PMID: 9020160) Meyers R. … Cantley L.C. (J. Biol. Chem. 1997) 2 3 4 22 64
  2. Human phosphatidylinositol 4-kinase isoform PI4K92. Expression of the recombinant enzyme and determination of multiple phosphorylation sites. (PMID: 11277933) Suer S. … Heilmeyer L.M.G. Jr. (Eur. J. Biochem. 2001) 3 4 22 64
  3. Complementary DNA cloning and chromosomal mapping of a novel phosphatidylinositol kinase gene. (PMID: 9405938) Saito T. … Hori T.-A. (DNA Res. 1997) 2 3 4 64
  4. Identification and characterization of a novel human phosphatidylinositol 4-kinase. (PMID: 9405935) Suzuki K. … Horie M. (DNA Res. 1997) 3 4 22 64
  5. ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding. (PMID: 23572552) Greninger A.L. … DeRisi J.L. (MBio 2013) 3 4 64

Products for PI4KB Gene

Sources for PI4KB Gene

Content
Loading form....