Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PI4KB Gene

Aliases for PI4KB Gene

  • Phosphatidylinositol 4-Kinase Beta 2 3 5
  • Phosphatidylinositol 4-Kinase, Catalytic, Beta 2 3
  • PtdIns 4-Kinase Beta 3 4
  • EC 2.7.1.67 4 58
  • PI4K-BETA 3 4
  • PI4KBETA 3 4
  • PIK4CB 3 4
  • PI4K92 3 4
  • NPIK 3 4
  • Phosphatidylinositol 4-Kinase, Wortmannin-Sensitive 3
  • Type III Phosphatidylinositol 4-Kinase Beta 3
  • PI4KIIIBETA 3
  • EC 2.7.1 58

External Ids for PI4KB Gene

Previous HGNC Symbols for PI4KB Gene

  • PIK4CB

Previous GeneCards Identifiers for PI4KB Gene

  • GC01M149532
  • GC01M151264
  • GC01M122642

Summaries for PI4KB Gene

GeneCards Summary for PI4KB Gene

PI4KB (Phosphatidylinositol 4-Kinase Beta) is a Protein Coding gene. Among its related pathways are Metabolism and Inositol phosphate metabolism (KEGG). GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and 1-phosphatidylinositol 4-kinase activity.

UniProtKB/Swiss-Prot for PI4KB Gene

  • Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking (By similarity).

Gene Wiki entry for PI4KB Gene

Additional gene information for PI4KB Gene

No data available for Entrez Gene Summary , CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PI4KB Gene

Genomics for PI4KB Gene

Regulatory Elements for PI4KB Gene

Enhancers for PI4KB Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01H151940 2 FANTOM5 Ensembl ENCODE dbSUPER 129.2 -616.4 -616383 7 PKNOX1 FOXA2 SIN3A FEZF1 ZNF2 ZBTB7B ZNF416 FOS DEK SP3 POGZ GABPB2 PI4KB MRPL9 PIP5K1A LYSMD1 ENSG00000229021 HRNR THEM4 C1orf56
GH01H151004 1.4 ENCODE dbSUPER 72.6 +320.3 320271 5 HDGF PKNOX1 FOXA2 ARNT ZFP64 ARID4B SIN3A YBX1 ZNF2 YY1 SETDB1 PIP5K1A PI4KB PRPF3 GOLPH3L ARNT UBE2D3P3 MRPL9 GABPB2 ZNF687
GH01H151068 1.2 ENCODE 78.6 +257.2 257230 3 FEZF1 YY1 ZNF416 ZNF143 ZNF548 SP3 MEF2D ZNF610 ZNF585B GLIS1 SETDB1 PI4KB GABPB2 PIP5K1A MRPL9 PRPF3 ARNT GOLPH3L UBE2D3P3 CTSK
GH01H152107 1.3 Ensembl ENCODE 62.3 -782.5 -782498 5 HDGF SIN3A FEZF1 ZNF2 ZBTB7B ZNF121 ZNF207 ZNF548 SP3 REST PI4KB PIP5K1A POGZ MRPL9 HRNR LYSMD1 ZNF687 ENSG00000229021 RN7SL444P TCHH
GH01H150557 1.7 Ensembl ENCODE dbSUPER 45.5 +758.4 758411 23 MLX DMAP1 YY1 SLC30A9 ZNF143 SP3 NFYC ZC3H11A SSRP1 ZNF610 SETDB1 PIP5K1A HORMAD1 GOLPH3L PI4KB ARNT GABPB2 RPRD2 SF3B4 PRPF3
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PI4KB on UCSC Golden Path with GeneCards custom track

Promoters for PI4KB Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000013609 315 2001 HDGF ARNT SIN3A DMAP1 YBX1 ZNF2 ZBTB7B YY1 ZNF302 SP3

Genomic Location for PI4KB Gene

Chromosome:
1
Start:
151,291,797 bp from pter
End:
151,327,715 bp from pter
Size:
35,919 bases
Orientation:
Minus strand

Genomic View for PI4KB Gene

Genes around PI4KB on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PI4KB Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PI4KB Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PI4KB Gene

Proteins for PI4KB Gene

  • Protein details for PI4KB Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9UBF8-PI4KB_HUMAN
    Recommended name:
    Phosphatidylinositol 4-kinase beta
    Protein Accession:
    Q9UBF8
    Secondary Accessions:
    • B4DGI2
    • O15096
    • P78405
    • Q5VWB9
    • Q5VWC0
    • Q5VWC1
    • Q9BWR6

    Protein attributes for PI4KB Gene

    Size:
    816 amino acids
    Molecular mass:
    91379 Da
    Quaternary structure:
    • Interacts with ARF1 and ARF3 in the Golgi complex, but not with ARF4, ARF5 or ARF6 (PubMed:17555535). Interacts with NCS1/FREQ in a calcium-independent manner. Interacts with CALN1/CABP8 and CALN2/CABP7; in a calcium-dependent manner; this interaction competes with NCS1/FREQ binding (By similarity). Interacts with ACBD3 (PubMed:27009356, PubMed:27989622, PubMed:23572552). Interacts with YWHAB, YWHAE, YWHAG, YWHAH, YWHAQ, YWHAZ and SFN (PubMed:23572552).
    SequenceCaution:
    • Sequence=BAA21661.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=CAH70326.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=EAW53450.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for PI4KB Gene

    Alternative splice isoforms for PI4KB Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PI4KB Gene

Selected DME Specific Peptides for PI4KB Gene

Q9UBF8:
  • FDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECEN
  • DSEIRCL
  • LSPSKRTHQRSKSDAT
  • LKRTASNPKVE
  • ERVPLWI
  • FIAAGDIRRRLSEQLAHTPT
  • EFVDVMGGL
  • RQNNSAKQSWLLRLFESKLFDISMA
  • IRSTRSVENLP
  • GHIIHIDFGF
  • EKVRRIREGSPYGH
  • PLELVNGDGVD
  • IGKRLATLPTKEQKTQRLISELSLLNHKLPARVWL
  • REFIKSLM
  • QVLKQLQSIWE
  • VEPAPLKP
  • KDRHNGN
  • GDMFNYYKMLMLQGLIAARKHMD
  • EIRCLDDPP
  • TVPNYDNDDEAWSVDDIGELQVELPE
  • GTAKGARR
  • SISLSSNLKRT
  • RCRQSINFSLQCA
  • DSGMIEPVVNAVSIHQVKKQSQL
  • VEIMQQGSQLPCFHGSSTIRNLKERFHM
  • KACQEVL
  • HTNSCDNISQFSVDSITSQESK
  • PNWRLLSVIVKCGDDLRQELLA
  • YFLQEHGS
  • AQRNFVQSCA

Post-translational modifications for PI4KB Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for PI4KB Gene

Gene Families for PI4KB Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

Q9UBF8

UniProtKB/Swiss-Prot:

PI4KB_HUMAN :
  • Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.
Family:
  • Belongs to the PI3/PI4-kinase family. Type III PI4K subfamily.
genes like me logo Genes that share domains with PI4KB: view

Function for PI4KB Gene

Molecular function for PI4KB Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Inhibited by wortmannin. Increased kinase activity upon interaction with NCS1/FREQ (By similarity).
UniProtKB/Swiss-Prot Function:
Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). May regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking (By similarity).

Enzyme Numbers (IUBMB) for PI4KB Gene

Phenotypes From GWAS Catalog for PI4KB Gene

Gene Ontology (GO) - Molecular Function for PI4KB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004430 1-phosphatidylinositol 4-kinase activity TAS --
GO:0005515 protein binding IPI 15324660
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with PI4KB: view
genes like me logo Genes that share phenotypes with PI4KB: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PI4KB

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for PI4KB
  • Applied Biological Materials Clones for PI4KB
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PI4KB Gene

Localization for PI4KB Gene

Subcellular locations from UniProtKB/Swiss-Prot for PI4KB Gene

Endomembrane system. Mitochondrion outer membrane; Peripheral membrane protein. Rough endoplasmic reticulum membrane; Peripheral membrane protein. Golgi apparatus. Golgi apparatus membrane. Cytoplasm, perinuclear region. Note=Found in the outer membrane of mitochondria and membranes of the rough endoplasmic reticulum. Recruited to the Golgi complex by the small GTPase ARF to stimulate the synthesis of phosphatidylinositol 4,5-bisphosphate (PIP2) on the Golgi complex. Recruited to the Golgi apparatus membrane by ACBD3. {ECO:0000269 PubMed:27009356}.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PI4KB gene
Compartment Confidence
cytosol 5
golgi apparatus 5
endosome 5
endoplasmic reticulum 4
mitochondrion 3
nucleus 2
plasma membrane 1
peroxisome 1
lysosome 1

Subcellular locations from the

Human Protein Atlas (HPA)
  • Golgi apparatus (3)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PI4KB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000139 Golgi membrane TAS --
GO:0005622 intracellular IEA --
GO:0005737 cytoplasm TAS 9584208
GO:0005739 mitochondrion IEA --
GO:0005741 mitochondrial outer membrane IEA --
genes like me logo Genes that share ontologies with PI4KB: view

Pathways & Interactions for PI4KB Gene

genes like me logo Genes that share pathways with PI4KB: view

SIGNOR curated interactions for PI4KB Gene

Is activated by:

Gene Ontology (GO) - Biological Process for PI4KB Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006661 phosphatidylinositol biosynthetic process TAS --
GO:0006898 receptor-mediated endocytosis TAS 9584208
GO:0007165 signal transduction TAS 9020160
GO:0016310 phosphorylation IEA --
GO:0046854 phosphatidylinositol phosphorylation IEA --
genes like me logo Genes that share ontologies with PI4KB: view

Drugs & Compounds for PI4KB Gene

(3) Drugs for PI4KB Gene - From: ApexBio, DGIdb, HMDB, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
PIK-93 Pharma PI3Kγ/PI4KIIIβ/PI3Kα inhibitor 0
Wortmannin Pharma PI3K inhibitor,selective and irreversible 0
ATP Nutra Agonist 0

(3) Additional Compounds for PI4KB Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0

(1) ApexBio Compounds for PI4KB Gene

Compound Action Cas Number
PIK-93 PI3Kγ/PI4KIIIβ/PI3Kα inhibitor 593960-11-3
genes like me logo Genes that share compounds with PI4KB: view

Drug Products

Transcripts for PI4KB Gene

Unigene Clusters for PI4KB Gene

Phosphatidylinositol 4-kinase, catalytic, beta:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for PI4KB
  • Applied Biological Materials Clones for PI4KB
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for PI4KB Gene

ExUns: 1a · 1b · 1c · 1d ^ 2a · 2b · 2c · 2d ^ 3 ^ 4a · 4b · 4c ^ 5 ^ 6 ^ 7 ^ 8a · 8b · 8c ^ 9a · 9b · 9c ^ 10 ^ 11 ^ 12a · 12b ^ 13a ·
SP1: - - - - - - -
SP2: - - -
SP3: - - -
SP4: - - - - - - - -
SP5:
SP6:
SP7: - - - - - - - - - -
SP8: - - - - - - -
SP9: -
SP10: - - - - - -
SP11: - - - -
SP12:
SP13:
SP14:

ExUns: 13b · 13c ^ 14a · 14b · 14c ^ 15 ^ 16a · 16b · 16c · 16d
SP1: - -
SP2: - -
SP3: - -
SP4: - -
SP5: -
SP6:
SP7:
SP8:
SP9:
SP10:
SP11:
SP12: - - -
SP13:
SP14:

Relevant External Links for PI4KB Gene

GeneLoc Exon Structure for
PI4KB
ECgene alternative splicing isoforms for
PI4KB

Expression for PI4KB Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PI4KB Gene

Protein differential expression in normal tissues from HIPED for PI4KB Gene

This gene is overexpressed in Frontal cortex (13.7), CD8 Tcells (9.2), Lymph node (7.4), and Retina (7.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, MaxQB, and MOPED for PI4KB Gene



NURSA nuclear receptor signaling pathways regulating expression of PI4KB Gene:

PI4KB

SOURCE GeneReport for Unigene cluster for PI4KB Gene:

Hs.632465

mRNA Expression by UniProt/SwissProt for PI4KB Gene:

Q9UBF8-PI4KB_HUMAN
Tissue specificity: Widely expressed with highest levels in heart, skeletal muscle, pancreas, testis and ovary. Weakly expressed in liver.

Evidence on tissue expression from TISSUES for PI4KB Gene

  • Nervous system(4.8)
  • Liver(4.2)
  • Kidney(2.1)
  • Lung(2.1)
genes like me logo Genes that share expression patterns with PI4KB: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PI4KB Gene

Orthologs for PI4KB Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PI4KB Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PI4KB 33 34
  • 99.64 (n)
oppossum
(Monodelphis domestica)
Mammalia PI4KB 34
  • 94 (a)
OneToOne
cow
(Bos Taurus)
Mammalia PI4KB 33 34
  • 93.47 (n)
dog
(Canis familiaris)
Mammalia PI4KB 34 33
  • 93.16 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Pi4kb 33 16 34
  • 92.59 (n)
rat
(Rattus norvegicus)
Mammalia Pi4kb 33
  • 92.57 (n)
chicken
(Gallus gallus)
Aves PI4KB 33 34
  • 80.27 (n)
lizard
(Anolis carolinensis)
Reptilia PI4KB 34
  • 82 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pi4kb 33
  • 77.96 (n)
zebrafish
(Danio rerio)
Actinopterygii pi4kb 33 34
  • 75.92 (n)
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.9571 33
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP007512 33
  • 59.17 (n)
fruit fly
(Drosophila melanogaster)
Insecta fwd 33 34
  • 53.45 (n)
worm
(Caenorhabditis elegans)
Secernentea pifk-1 33 34
  • 48.04 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PIK1 34 36
  • 23 (a)
OneToOne
sea squirt
(Ciona savignyi)
Ascidiacea CSA.2331 34
  • 56 (a)
OneToOne
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.5032 33
Species where no ortholog for PI4KB was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • platypus (Ornithorhynchus anatinus)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PI4KB Gene

ENSEMBL:
Gene Tree for PI4KB (if available)
TreeFam:
Gene Tree for PI4KB (if available)

Paralogs for PI4KB Gene

genes like me logo Genes that share paralogs with PI4KB: view

No data available for Paralogs for PI4KB Gene

Variants for PI4KB Gene

Sequence variations from dbSNP and Humsavar for PI4KB Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs1000103816 -- 151,316,900(+) TCACT(C/G)TAAGT intron-variant
rs1000179997 -- 151,291,336(+) AACCT(-/GAA)GAAGA downstream-variant-500B, utr-variant-3-prime, cds-indel
rs1000230908 -- 151,291,651(+) GCCCC(C/T)GCCCC downstream-variant-500B, utr-variant-3-prime
rs1000236002 -- 151,312,632(+) ATGAA(C/T)GTTAC intron-variant
rs1000452105 -- 151,326,735(+) CCAGG(A/G)GCTGG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for PI4KB Gene

Variant ID Type Subtype PubMed ID
dgv2n68 CNV loss 17160897
esv25158 CNV gain 19812545
esv2717851 CNV deletion 23290073
esv34461 CNV gain 17911159
nsv2821 CNV insertion 18451855
nsv522840 CNV gain 19592680
nsv831581 CNV loss 17160897

Variation tolerance for PI4KB Gene

Residual Variation Intolerance Score: 4.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.71; 32.54% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PI4KB Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PI4KB

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PI4KB Gene

Disorders for PI4KB Gene

Relevant External Links for PI4KB

Genetic Association Database (GAD)
PI4KB
Human Genome Epidemiology (HuGE) Navigator
PI4KB
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PI4KB

No disorders were found for PI4KB Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PI4KB Gene

Publications for PI4KB Gene

  1. Cloning and characterization of a wortmannin-sensitive human phosphatidylinositol 4-kinase. (PMID: 9020160) Meyers R … Cantley LC (The Journal of biological chemistry 1997) 2 3 4 22 60
  2. Human phosphatidylinositol 4-kinase isoform PI4K92. Expression of the recombinant enzyme and determination of multiple phosphorylation sites. (PMID: 11277933) Suer S … Heilmeyer LM (European journal of biochemistry 2001) 3 4 22 60
  3. Complementary DNA cloning and chromosomal mapping of a novel phosphatidylinositol kinase gene. (PMID: 9405938) Saito T … Hori T (DNA research : an international journal for rapid publication of reports on genes and genomes 1997) 2 3 4 60
  4. Identification and characterization of a novel human phosphatidylinositol 4-kinase. (PMID: 9405935) Suzuki K … Horie M (DNA research : an international journal for rapid publication of reports on genes and genomes 1997) 3 4 22 60
  5. Structural insights and in vitro reconstitution of membrane targeting and activation of human PI4KB by the ACBD3 protein. (PMID: 27009356) Klima M … Boura E (Scientific reports 2016) 3 4 60

Products for PI4KB Gene

  • Addgene plasmids for PI4KB

Sources for PI4KB Gene

Content
Loading form....