Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PGGT1B Gene

Aliases for PGGT1B Gene

  • Protein Geranylgeranyltransferase Type I Subunit Beta 2 3 5
  • Protein Geranylgeranyltransferase Type I, Beta Subunit 2 3
  • Type I Protein Geranyl-Geranyltransferase Subunit Beta 3 4
  • Geranylgeranyl Transferase Type I Subunit Beta 3 4
  • GGTase-I-Beta 3 4
  • EC 2.5.1.59 4 61
  • Geranylgeranyl Transferase Type-1 Subunit Beta 3
  • Geranylgeranyltransferase Type I Beta Subunit 3
  • CTC-428G20.3 3
  • EC 2.5.1 61
  • BGGI 3
  • GGTI 3

External Ids for PGGT1B Gene

Previous GeneCards Identifiers for PGGT1B Gene

  • GC05M114151
  • GC05M114950
  • GC05M114578
  • GC05M114623
  • GC05M114575
  • GC05M109728
  • GC05M114546

Summaries for PGGT1B Gene

Entrez Gene Summary for PGGT1B Gene

  • Protein geranylgeranyltransferase type I (GGTase-I) transfers a geranylgeranyl group to the cysteine residue of candidate proteins containing a C-terminal CAAX motif in which 'A' is an aliphatic amino acid and 'X' is leucine (summarized by Zhang et al., 1994 [PubMed 8106351]). The enzyme is composed of a 48-kD alpha subunit (FNTA; MIM 134635) and a 43-kD beta subunit, encoded by the PGGT1B gene. The FNTA gene encodes the alpha subunit for both GGTase-I and the related enzyme farnesyltransferase.[supplied by OMIM, Mar 2010]

GeneCards Summary for PGGT1B Gene

PGGT1B (Protein Geranylgeranyltransferase Type I Subunit Beta) is a Protein Coding gene. Among its related pathways are G-protein signaling_Rap1B regulation pathway and G-protein signaling_Rac2 regulation pathway. GO annotations related to this gene include drug binding and protein geranylgeranyltransferase activity. An important paralog of this gene is RABGGTB.

UniProtKB/Swiss-Prot for PGGT1B Gene

  • Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Known substrates include RAC1, RAC2, RAP1A and RAP1B.

Tocris Summary for PGGT1B Gene

No data available for Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PGGT1B Gene

Genomics for PGGT1B Gene

Regulatory Elements for PGGT1B Gene

Enhancers for PGGT1B Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH05F115288 0.2 Ensembl 11.8 -26.2 -26214 0.6 RPS2P26 PGGT1B LOC101927100 TICAM2 TMED7-TICAM2 HMGN1P15
GH05F115541 1.3 FANTOM5 ENCODE 10.7 -280.6 -280598 4.4 HDGF PKNOX1 CREB3L1 ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 SLC30A9 ENSG00000271918 ENSG00000250015 SEMA6A-AS1 ATG12 LOC101927078 HMGN2P27 CCT5P1 PGGT1B LOC101927100 TICAM2
GH05F115601 0.6 ENCODE 10.7 -339.7 -339688 2.8 TBP PKNOX1 CBX3 CREB3L1 SIN3A ZBTB40 GLIS2 CBX5 ETV6 FOS ENSG00000271918 ENSG00000250015 PGGT1B SEMA6A-AS1 ATG12 TICAM2 LOC101927100 TMED7-TICAM2
GH05F115831 0.2 ENCODE 10.7 -568.4 -568432 0.2 CTCF ZNF384 RAD21 TEAD3 FOXK2 ZNF143 SMC3 FOS HOMEZ MIXL1 ENSG00000271918 PGGT1B ATG12 CDO1 AP3S1
GH05F115838 1.1 ENCODE 10.7 -579.2 -579240 6.3 HDGF PKNOX1 ARNT CREB3L1 MLX WRNIP1 ZFP64 ARID4B SIN3A FEZF1 CDO1 ENSG00000271918 ATG12 PGGT1B ENSG00000280329
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around PGGT1B on UCSC Golden Path with GeneCards custom track

Promoters for PGGT1B Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001412932 387 2200 PKNOX1 CREB3L1 WRNIP1 ZFP64 ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9

Genomic Location for PGGT1B Gene

Chromosome:
5
Start:
115,200,241 bp from pter
End:
115,262,887 bp from pter
Size:
62,647 bases
Orientation:
Minus strand

Genomic View for PGGT1B Gene

Genes around PGGT1B on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PGGT1B Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PGGT1B Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PGGT1B Gene

Proteins for PGGT1B Gene

  • Protein details for PGGT1B Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P53609-PGTB1_HUMAN
    Recommended name:
    Geranylgeranyl transferase type-1 subunit beta
    Protein Accession:
    P53609
    Secondary Accessions:
    • Q5MJP9

    Protein attributes for PGGT1B Gene

    Size:
    377 amino acids
    Molecular mass:
    42368 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Heterodimer of FNTA and PGGT1B. PGGT1B mediates interaction with substrate peptides.

    Alternative splice isoforms for PGGT1B Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PGGT1B Gene

Selected DME Specific Peptides for PGGT1B Gene

P53609:
  • QLEDGSF
  • FGICGLSLM
  • YIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEE

Post-translational modifications for PGGT1B Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for PGGT1B Gene

Domains & Families for PGGT1B Gene

Protein Domains for PGGT1B Gene

Suggested Antigen Peptide Sequences for PGGT1B Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P53609

UniProtKB/Swiss-Prot:

PGTB1_HUMAN :
  • Belongs to the protein prenyltransferase subunit beta family.
  • Contains 4 PFTB repeats.
Family:
  • Belongs to the protein prenyltransferase subunit beta family.
Similarity:
  • Contains 4 PFTB repeats.
genes like me logo Genes that share domains with PGGT1B: view

No data available for Gene Families for PGGT1B Gene

Function for PGGT1B Gene

Molecular function for PGGT1B Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate.
UniProtKB/Swiss-Prot Function:
Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Known substrates include RAC1, RAC2, RAP1A and RAP1B.

Enzyme Numbers (IUBMB) for PGGT1B Gene

Gene Ontology (GO) - Molecular Function for PGGT1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004659 prenyltransferase activity IEA --
GO:0004661 protein geranylgeranyltransferase activity IDA 16893176
GO:0004662 CAAX-protein geranylgeranyltransferase activity ISS,TAS --
GO:0008144 drug binding IEA --
GO:0008270 zinc ion binding ISS --
genes like me logo Genes that share ontologies with PGGT1B: view
genes like me logo Genes that share phenotypes with PGGT1B: view

Animal Models for PGGT1B Gene

MGI Knock Outs for PGGT1B:

Animal Model Products

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PGGT1B Gene

Localization for PGGT1B Gene

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for PGGT1B Gene COMPARTMENTS Subcellular localization image for PGGT1B gene
Compartment Confidence
cytosol 3
nucleus 3
cytoskeleton 1
peroxisome 1

Gene Ontology (GO) - Cellular Components for PGGT1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005953 CAAX-protein geranylgeranyltransferase complex IDA,TAS 16893176
genes like me logo Genes that share ontologies with PGGT1B: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for PGGT1B Gene

Pathways & Interactions for PGGT1B Gene

genes like me logo Genes that share pathways with PGGT1B: view

Gene Ontology (GO) - Biological Process for PGGT1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0008284 positive regulation of cell proliferation IEA --
GO:0018344 protein geranylgeranylation IDA,TAS 16893176
GO:0034097 response to cytokine IEA --
GO:0045787 positive regulation of cell cycle IEA --
GO:0051771 negative regulation of nitric-oxide synthase biosynthetic process IEA --
genes like me logo Genes that share ontologies with PGGT1B: view

No data available for SIGNOR curated interactions for PGGT1B Gene

Drugs & Compounds for PGGT1B Gene

(6) Drugs for PGGT1B Gene - From: DrugBank, DGIdb, HMDB, and Tocris

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Pravastatin Approved Pharma Competitive, Inhibitor 149
2-[METHYL-(5-GERANYL-4-METHYL-PENT-3-ENYL)-AMINO]-ETHYL-DIPHOSPHATE Experimental Pharma Target 0
4-[(5-{[4-(3-CHLOROPHENYL)-3-OXOPIPERAZIN-1-YL]METHYL}-1H-IMIDAZOL-1-YL)METHYL]BENZONITRILE Experimental Pharma Target 0
GERANYLGERANYL DIPHOSPHATE Experimental Pharma Feedback inhibition, Inhibitor, Target 0
GGTI-2418 Pharma 0

(3) Additional Compounds for PGGT1B Gene - From: HMDB and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
Geranylgeranyl-PP
  • 2-trans,6-trans,10-trans-Geranylgeranyl diphosphate
  • 3,7,11,15-Tetramethyl-2,6,10,14-hexadecatetraenyl diphosphate
  • All-trans-geranyl-geranyl-pp
  • Geranylgeranyl-diphosphate
  • Geranylgeranyl-PP
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
FTI 277
1217447-06-7

(2) Tocris Compounds for PGGT1B Gene

Compound Action Cas Number
FTI 277 Prodrug form of FTI 276 (Cat. No. 2406) 1217447-06-7
LB 42708 Selective farnesyltransferase (FTase) inhibitor 226929-39-1
genes like me logo Genes that share compounds with PGGT1B: view

Transcripts for PGGT1B Gene

Unigene Clusters for PGGT1B Gene

Protein geranylgeranyltransferase type I, beta subunit:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for PGGT1B Gene

No ASD Table

Relevant External Links for PGGT1B Gene

GeneLoc Exon Structure for
PGGT1B
ECgene alternative splicing isoforms for
PGGT1B

Expression for PGGT1B Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PGGT1B Gene

Protein differential expression in normal tissues from HIPED for PGGT1B Gene

This gene is overexpressed in Peripheral blood mononuclear cells (7.6) and Spleen (7.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PGGT1B Gene



Protein tissue co-expression partners for PGGT1B Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PGGT1B Gene:

PGGT1B

SOURCE GeneReport for Unigene cluster for PGGT1B Gene:

Hs.254006
genes like me logo Genes that share expression patterns with PGGT1B: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for PGGT1B Gene

Orthologs for PGGT1B Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PGGT1B Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PGGT1B 34 35
  • 99.65 (n)
oppossum
(Monodelphis domestica)
Mammalia PGGT1B 35
  • 95 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia PGGT1B 35
  • 95 (a)
OneToOne
dog
(Canis familiaris)
Mammalia PGGT1B 34 35
  • 94.08 (n)
cow
(Bos Taurus)
Mammalia PGGT1B 34 35
  • 92.48 (n)
rat
(Rattus norvegicus)
Mammalia Pggt1b 34
  • 89.92 (n)
mouse
(Mus musculus)
Mammalia Pggt1b 34 16 35
  • 87.18 (n)
chicken
(Gallus gallus)
Aves PGGT1B 34 35
  • 82.01 (n)
lizard
(Anolis carolinensis)
Reptilia PGGT1B 35
  • 86 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pggt1b 34
  • 74.84 (n)
Str.1329 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.4454 34
zebrafish
(Danio rerio)
Actinopterygii pggt1b 34 35
  • 65.71 (n)
Dr.10651 34
fruit fly
(Drosophila melanogaster)
Insecta betaggt-I 34 35
  • 51.55 (n)
bgrggt-I 36
  • 44 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008406 34
  • 51.46 (n)
worm
(Caenorhabditis elegans)
Secernentea Y48E1B.3 34 35
  • 51.13 (n)
csp-1 36
  • 40 (a)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes BET2 35
  • 27 (a)
OneToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons PGGT-I 34
  • 51.04 (n)
rice
(Oryza sativa)
Liliopsida Os01g0150100 34
  • 52.67 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.3753 35
  • 51 (a)
OneToOne
Species where no ortholog for PGGT1B was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PGGT1B Gene

ENSEMBL:
Gene Tree for PGGT1B (if available)
TreeFam:
Gene Tree for PGGT1B (if available)

Paralogs for PGGT1B Gene

Paralogs for PGGT1B Gene

Pseudogenes.org Pseudogenes for PGGT1B Gene

genes like me logo Genes that share paralogs with PGGT1B: view

Variants for PGGT1B Gene

Sequence variations from dbSNP and Humsavar for PGGT1B Gene

SNP ID Clin Chr 05 pos Sequence Context AA Info Type
rs10037792 -- 115,225,250(+) ACCTA(C/T)GTGAT intron-variant
rs10045548 -- 115,227,751(+) tcttt(A/C)atact intron-variant
rs1005056 -- 115,245,045(+) TCAAG(C/T)TACTA intron-variant
rs10055927 -- 115,241,842(+) TTTTT(A/T)ATAGC intron-variant
rs10059069 -- 115,208,202(+) gaatc(A/C)atgct intron-variant, nc-transcript-variant, utr-variant-3-prime

Structural Variations from Database of Genomic Variants (DGV) for PGGT1B Gene

Variant ID Type Subtype PubMed ID
esv3566493 CNV deletion 23714750
nsv1029371 CNV loss 25217958
nsv478622 CNV novel sequence insertion 20440878
nsv830453 CNV gain 17160897
nsv830454 CNV gain+loss 17160897
nsv980715 CNV duplication 23825009

Variation tolerance for PGGT1B Gene

Residual Variation Intolerance Score: 23.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.53; 44.12% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PGGT1B Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PGGT1B

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PGGT1B Gene

Disorders for PGGT1B Gene

Relevant External Links for PGGT1B

Genetic Association Database (GAD)
PGGT1B
Human Genome Epidemiology (HuGE) Navigator
PGGT1B
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PGGT1B

No disorders were found for PGGT1B Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PGGT1B Gene

Publications for PGGT1B Gene

  1. cDNA cloning and expression of rat and human protein geranylgeranyltransferase type-I. (PMID: 8106351) Zhang F.L. … Omer C.A. (J. Biol. Chem. 1994) 2 3 4 64
  2. Genome-wide scan of 500,000 single-nucleotide polymorphisms among responders and nonresponders to interferon beta therapy in multiple sclerosis. (PMID: 19667218) Comabella M. … Montalban X. (Arch. Neurol. 2009) 3 46 64
  3. The BioPlex Network: A Systematic Exploration of the Human Interactome. (PMID: 26186194) Huttlin E.L. … Gygi S.P. (Cell 2015) 3 64
  4. Geranylgeranyltransferase I regulates HIF-1I+ promoting glioblastoma cell migration and invasion. (PMID: 23475391) Zhou X. … Yu R. (J. Neurooncol. 2013) 3 64
  5. Geranylgeranyl transferase 1 modulates autophagy and apoptosis in human airway smooth muscle. (PMID: 22160308) Ghavami S. … Halayko A.J. (Am. J. Physiol. Lung Cell Mol. Physiol. 2012) 3 64

Products for PGGT1B Gene

Sources for PGGT1B Gene

Content
Loading form....