Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 



PGGT1B Gene

protein-coding   GIFtS: 56
GCID: GC05M114546

Protein Geranylgeranyltransferase Type I, Beta Subunit

  See related diseases
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

TryGeneCards Plus

Aliases
Protein Geranylgeranyltransferase Type I, Beta Subunit1 2     BGGI2
Geranylgeranyl Transferase Type I Subunit Beta2 3     GGTI2
Type I Protein Geranyl-Geranyltransferase Subunit Beta2 3     Geranylgeranyl Transferase Type-1 Subunit Beta2
GGTase-I-beta2 3     Geranylgeranyltransferase Type I Beta Subunit2
EC 2.5.1.593 8     EC 2.5.18

External Ids:    HGNC: 88951   Entrez Gene: 52292   Ensembl: ENSG000001642197   OMIM: 6020315   UniProtKB: P536093   

Export aliases for PGGT1B gene to outside databases

Previous GC identifers: GC05M114151 GC05M114950 GC05M114578 GC05M114623 GC05M114575 GC05M109728


(According to Entrez Gene, GeneCards, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

TryGeneCards Plus

Entrez Gene summary for PGGT1B Gene:
Protein geranylgeranyltransferase type I (GGTase-I) transfers a geranylgeranyl group to the cysteine residue of
candidate proteins containing a C-terminal CAAX motif in which 'A' is an aliphatic amino acid and 'X' is leucine
(summarized by Zhang et al., 1994 (PubMed 8106351)). The enzyme is composed of a 48-kD alpha subunit (FNTA; MIM
134635) and a 43-kD beta subunit, encoded by the PGGT1B gene. The FNTA gene encodes the alpha subunit for both
GGTase-I and the related enzyme farnesyltransferase.(supplied by OMIM, Mar 2010)

GeneCards Summary for PGGT1B Gene:
PGGT1B (protein geranylgeranyltransferase type I, beta subunit) is a protein-coding gene. Diseases associated with PGGT1B include progeria, and multiple sclerosis. GO annotations related to this gene include CAAX-protein geranylgeranyltransferase activity. An important paralog of this gene is RABGGTB.

UniProtKB/Swiss-Prot: PGTB1_HUMAN, P53609
Function: Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at
the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.
Known substrates include RAC1, RAC2, RAP1A and RAP1B




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 75), Regulatory elements and Epigenetics data according to QIAGEN, and/or SwitchGear Genomics)
About This Section

TryGeneCards Plus
RefSeq DNA sequence:
NC_000005.10  NT_034772.7  NC_018916.2  
Regulatory elements:
   Regulatory transcription factor binding sites in the PGGT1B gene promoter:
         TBP   AML1a   HTF   Pax-6   Nkx2-2   E4BP4   FOXO4   FOXJ2 (long isoform)   STAT3   FOXJ2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidPGGT1B promoter sequence
   Search Chromatin IP Primers for PGGT1B

Epigenetics:
DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat PGGT1B


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 5q22.3   Ensembl cytogenetic band:  5q22.3   HGNC cytogenetic band: 5q23.1

PGGT1B Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
PGGT1B gene location

GeneLoc information about chromosome 5         GeneLoc Exon Structure

GeneLoc location for GC05M114546:  view genomic region     (about GC identifiers)

Start:
114,546,527 bp from pter      End:
114,598,569 bp from pter
Size:
52,043 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, 2neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Antibodies by EMD Millipore, R&D Systems, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

TryGeneCards Plus

UniProtKB/Swiss-Prot: PGTB1_HUMAN, P53609 (See protein sequence)
Recommended Name: Geranylgeranyl transferase type-1 subunit beta  
Size: 377 amino acids; 42368 Da
Cofactor: Binds 1 zinc ion per subunit (By similarity)
Subunit: Heterodimer of FNTA and PGGT1B. PGGT1B mediates interaction with substrate peptides
Secondary accessions: Q5MJP9
Alternative splicing: 2 isoforms:  P53609-1   P53609-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for PGGT1B: NX_P53609

Explore proteomics data for PGGT1B at MOPED

Post-translational modifications: 

  • Modification sites at neXtProt
  • Modification sites at PhosphoSitePlus
  • 3 DME Specific Peptides for PGGT1B (P53609)
     QLEDGSF  FGICGLSLM  YIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEE 


    See PGGT1B Protein Expression from SPIRE MOPED, PaxDB, and MaxQB

    REFSEQ proteins: NP_005014.2  
    ENSEMBL proteins: 
     ENSP00000404676   ENSP00000368935  

    PGGT1B Human Recombinant Protein Products:

    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate for PGGT1B
    OriGene Custom MassSpec
    OriGene Custom Protein Services for PGGT1B
    GenScript Custom Purified and Recombinant Proteins Services for PGGT1B
    Novus Biologicals PGGT1B Protein
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates
    Browse ProSpec Recombinant Proteins
    Browse Proteins at Cloud-Clone Corp.

    PGGT1B Antibody Products:

    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for PGGT1B
    Novus Biologicals PGGT1B Antibodies
    Abcam antibodies for PGGT1B
    Browse Antibodies at Cloud-Clone Corp.
    Search ThermoFisher Antibodies for PGGT1B
    LSBio Antibodies in human, mouse, rat for PGGT1B

    PGGT1B Assay Products:

    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for PGGT1B
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for PGGT1B
    Browse Enzo Life Sciences for kits & assays
    Browse ELISAs at Cloud-Clone Corp.
    Browse CLIAs at Cloud-Clone Corp.


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    TryGeneCards Plus
    2 InterPro protein domains:
     IPR008930 Terpenoid_cyclase/PrenylTrfase
     IPR001330 Prenyltrans

    Graphical View of Domain Structure for InterPro Entry P53609

    ProtoNet protein and cluster: P53609

    1 Blocks protein domain: IPB001330 Prenyltransferase/squalene oxidase

    UniProtKB/Swiss-Prot: PGTB1_HUMAN, P53609
    Similarity: Belongs to the protein prenyltransferase subunit beta family
    Similarity: Contains 4 PFTB repeats


    PGGT1B for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    transcription factor targeting from QIAGEN and/or HOMER, miRNA Gene Targets from miRTarBase, shRNA from OriGene, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, SwitchGear Genomics, Gene Editing from DNA2.0, Clones from OriGene, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, ESI BIO, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: PGTB1_HUMAN, P53609
    Function: Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at
    the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.
    Known substrates include RAC1, RAC2, RAP1A and RAP1B
    Catalytic activity: Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate

         Enzyme Numbers (IUBMB): EC 2.5.1.591 2 EC 2.5.12

         Gene Ontology (GO): Selected molecular function terms (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0003824catalytic activity ----
    GO:0004661protein geranylgeranyltransferase activity IDA16893176
    GO:0004662CAAX-protein geranylgeranyltransferase activity ISS--
    GO:0005515protein binding ----
    GO:0008270zinc ion binding ISS--
         
    PGGT1B for ontologies           About GeneDecksing


    Phenotypes:
         9 MGI mutant phenotypes (inferred from 2 alleles(MGI details for Pggt1b):
     cellular  growth/size/body  hematopoietic system  immune system  integument 
     liver/biliary system  mortality/aging  respiratory system  tumorigenesis 

    PGGT1B for phenotypes           About GeneDecksing

    Animal Models:
         MGI mouse knock-out Pggt1btm1.1Mbrg for PGGT1B

       inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for PGGT1B
       inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for PGGT1B

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for PGGT1B
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for PGGT1B

    miRNA
    Products:
        
    miRTarBase miRNAs that target PGGT1B:
    hsa-mir-124-3p (MIRT022675)

    Block miRNA regulation of human, mouse, rat PGGT1B using miScript Target Protectors
    Selected qRT-PCR Assays for microRNAs that regulate PGGT1B (see all 28):
    hsa-miR-579 hsa-miR-30c hsa-miR-892b hsa-miR-3146 hsa-miR-1271 hsa-miR-548v hsa-miR-30d hsa-miR-219-5p
    SwitchGear 3'UTR luciferase reporter plasmidPGGT1B 3' UTR sequence
    Inhib. RNA
    Products:
        
    OriGene RNAi products in human, mouse, rat for PGGT1B
    Predesigned siRNA for gene silencing in human, mouse, rat PGGT1B

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for PGGT1B

    Clone
    Products:
         
    OriGene clones in human, mouse for PGGT1B (see all 6)
    OriGene ORF clones in mouse, rat for PGGT1B
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: PGGT1B (NM_005023)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for PGGT1B
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PGGT1B

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for PGGT1B
    Browse ESI BIO Cell Lines and PureStem Progenitors for PGGT1B 
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for PGGT1B


    (According to UniProtKB, COMPARTMENTS Subcellular localization database, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Subcellular locations from COMPARTMENTS: 

    CompartmentConfidence
    cytosol2
    nucleus2
    peroxisome1

    Gene Ontology (GO): 1 cellular component term:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005953CAAX-protein geranylgeranyltransferase complex IDA16893176

    PGGT1B for ontologies           About GeneDecksing


    (SuperPaths according to PathCards, Pathways according to R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to QIAGEN, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene).
    About This Section

    TryGeneCards Plus

    SuperPaths for PGGT1B About   (see all 8)                                                                                              See pathways by source

    SuperPathContained pathways About
    1G protein signaling RhoB regulation pathway
    G protein signaling RhoB regulation pathway
    2G protein signaling RhoA regulation pathway
    G protein signaling RhoA regulation pathway
    3G protein signaling Regulation of RAC1 activity
    G protein signaling Regulation of RAC1 activity
    4G protein signaling Rap2B regulation pathway
    G protein signaling Rap2B regulation pathway
    5G protein signaling Rap1B regulation pathway
    G protein signaling Rap1B regulation pathway

    Pathways by source                                                                                                                                                                 See SuperPaths
    Show all pathways


    Selected GeneGo (Thomson Reuters) Pathways for PGGT1B (see all 8)
        G-protein signaling Regulation of RAC1 activity
    G-protein signaling Rap1A regulation pathway
    G-protein signaling Rac2 regulation pathway
    G-protein signaling Rap2B regulation pathway
    G-protein signaling RhoB regulation pathway


        Custom Pathway & Disease-focused RT2 Profiler PCR Arrays for PGGT1B
    Interactions:

        Search GeneGlobe Interaction Network for PGGT1B

    STRING Interaction Network Preview (showing 5 interactants - click image to see 16)

    Selected Interacting proteins for PGGT1B (P536093 ENSP000004046764) via UniProtKB, MINT, STRING, and/or I2D (see all 18)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    FNTAP493543, ENSP000003034234I2D: score=2 STRING: ENSP00000303423
    RHOBP627453, ENSP000002722334I2D: score=1 STRING: ENSP00000272233
    ROS1P089223, ENSP000003574944I2D: score=1 STRING: ENSP00000357494
    CDC42P609533, ENSP000003144584I2D: score=1 STRING: ENSP00000314458
    GNG2P597683, ENSP000003344484I2D: score=1 STRING: ENSP00000334448
    About this table

    Gene Ontology (GO): 5 biological process terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0008284positive regulation of cell proliferation IEA--
    GO:0018344protein geranylgeranylation IDA16893176
    GO:0034097response to cytokine IEA--
    GO:0045787positive regulation of cell cycle IEA--
    GO:0051771negative regulation of nitric-oxide synthase biosynthetic process IEA--

    PGGT1B for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience, ApexBio, HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB)
    About This Section

    TryGeneCards Plus
    Browse Small Molecules at EMD Millipore
       Browse drugs & compounds from Enzo Life Sciences
      Browse compounds at ApexBio 

    Compounds for PGGT1B available from Tocris Bioscience    About this table
    CompoundAction CAS #
    FTI 276Farnesyltransferase (FTase) inhibitor; antitumor[170006-72-1]
    GGTI 297Geranylgeranyltransferase I (GGTase I) inhibitor--
    LB 42708Selective farnesyltransferase (FTase) inhibitor[226929-39-1]

    1 HMDB Compound for PGGT1B    About this table
    CompoundSynonyms CAS #PubMed Ids
    Pravastatin3beta-Hydroxycompactin (see all 7)81093-37-0--

    3 DrugBank Compounds for PGGT1B    About this table
    CompoundSynonyms CAS #TypeActionsPubMed Ids
    2-[METHYL-(5-GERANYL-4-METHYL-PENT-3-ENYL)-AMINO]-ETHYL-DIPHOSPHATE-- --target--10592235
    4-[(5-{[4-(3-CHLOROPHENYL)-3-OXOPIPERAZIN-1-YL]METHYL}-1H-IMIDAZOL-1-YL)METHYL]BENZONITRILE-- --target--10592235
    GERANYLGERANYL DIPHOSPHATE-- --target--10592235



    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN, SwitchGear Genomics,
    Tagged/untagged cDNA clones from OriGene, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, and/or QIAGEN )
    About This Section

    TryGeneCards Plus

    REFSEQ mRNAs for PGGT1B gene: 
    NM_005023.3  

    Unigene Cluster for PGGT1B:

    Protein geranylgeranyltransferase type I, beta subunit
    Hs.254006  [show with all ESTs]
    Unigene Representative Sequence: NM_005023
    5 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000419445(uc003kqw.4 uc010jch.3) ENST00000379615 ENST00000514178
    ENST00000296642 ENST00000503638
    miRNA
    Products:
         
    Block miRNA regulation of human, mouse, rat PGGT1B using miScript Target Protectors
    Selected qRT-PCR Assays for microRNAs that regulate PGGT1B (see all 28):
    hsa-miR-579 hsa-miR-30c hsa-miR-892b hsa-miR-3146 hsa-miR-1271 hsa-miR-548v hsa-miR-30d hsa-miR-219-5p
    SwitchGear 3'UTR luciferase reporter plasmidPGGT1B 3' UTR sequence
    Inhib. RNA
    Products:
         
    OriGene RNAi products in human, mouse, rat for PGGT1B
    Predesigned siRNA for gene silencing in human, mouse, rat PGGT1B
    Clone
    Products:
         
    OriGene clones in human, mouse for PGGT1B (see all 6)
    OriGene ORF clones in mouse, rat for PGGT1B
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: PGGT1B (NM_005023)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for PGGT1B
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PGGT1B
    Primer
    Products:
        
    OriGene qSTAR qPCR primer pairs in human, mouse for PGGT1B
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat PGGT1B
      QuantiTect SYBR Green Assays in human, mouse, rat PGGT1B
      QuantiFast Probe-based Assays in human, mouse, rat PGGT1B

    Additional mRNA sequence: AY780790.1 

    5 DOTS entries:

    DT.453258  DT.97790688  DT.92458575  DT.70105048  DT.106872 

    Selected AceView cDNA sequences (see all 41):

    AA961272 CK904573 AA789108 AA989220 AA281562 CR591401 AI284958 BM054888 
    AI435086 AU122784 AL520655 BU607890 BM979607 BU674247 AL520656 AI348055 
    BU633729 AI540086 CK904574 BX113067 NM_005023 AI911308 AA285159 AW779540 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MaxQB, plus additional links to SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from QIAGEN, Primers from OriGene, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TryGeneCards Plus

    PGGT1B expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: CTTAGTTTTA
    PGGT1B Expression
    About this image

    PGGT1B Protein expression data from MOPED1, PaxDb2 and MaxQB3    About this image

    PGGT1B Protein Expression

    SOURCE GeneReport for Unigene cluster: Hs.254006
        Custom PCR Arrays for PGGT1B
    Primer
    Products:
    OriGene qSTAR qPCR primer pairs in human, mouse for PGGT1B
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat PGGT1B
    QuantiTect SYBR Green Assays in human, mouse, rat PGGT1B
    QuantiFast Probe-based Assays in human, mouse, rat PGGT1B
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for PGGT1B

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    TryGeneCards Plus

    This gene was present in the common ancestor of eukaryotes.

    Orthologs for PGGT1B gene from Selected species (see all 19)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Pggt1b1 , 5 protein geranylgeranyltransferase type I, beta subunit1, 5 87.18(n)1
    96.82(a)1
      18 (24.45 cM)5
    2254671  NM_172627.31  NP_766215.11 
     462399495 
    chicken
    (Gallus gallus)
    Aves PGGT1B1 protein geranylgeranyltransferase type I, beta subunit 82.01(n)
    91.21(a)
      770633  XM_003643102.2  XP_003643150.1 
    lizard
    (Anolis carolinensis)
    Reptilia PGGT1B6
    protein geranylgeranyltransferase type I, beta sub...
    86(a)
    1 ↔ 1
    GL343193.1(8126349-8167997)
    African clawed frog
    (Xenopus laevis)
    Amphibia Xl.44542 Xenopus laevis transcribed sequence with moderate similarity more 78.61(n)    CA980858.1 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.106512 Transcribed sequence with moderate similarity to protein more 72.88(n)    CA476901.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta &bgr;ggt-I3
    betaggt-I1
    RAS protein signal transduction
    CAAX-protein geranylgeranyltransferase3
    beta subunit of type I geranylgeranyl transferase1
    44(a)3
    51.55(n)1
    45.93(a)1
      2 25B43
    337041  NM_001273132.11  NP_001260061.11 
    worm
    (Caenorhabditis elegans)
    Secernentea csp-13
    Y48E1B.31
    C14 peptidase3
    Y48E1B.31
    40(a)3
    51.13(n)1
    44.25(a)1
      II(13547827-13567858)3
    1749991  NM_001267468.11  NP_001254397.11 
    baker's yeast
    (Saccharomyces cerevisiae)
    Saccharomycetes BET26
    Beta subunit of Type II geranylgeranyltransferase ...
    27(a)
    1 → many
    XVI(891101-892078) YPR176C
    thale cress
    (Arabidopsis thaliana)
    eudicotyledons PGGT-I1 PGGT-I 51.04(n)
    41.93(a)
      818540  NM_129513.3  NP_181487.1 
    rice
    (Oryza sativa)
    Liliopsida Os01g01501001 Os01g0150100 52.67(n)
    43.21(a)
      4324517  NM_001048566.1  NP_001042031.1 


    ENSEMBL Gene Tree for PGGT1B (if available)
    TreeFam Gene Tree for PGGT1B (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section

    TryGeneCards Plus
    Paralogs for PGGT1B gene
    RABGGTB2  

    PGGT1B for paralogs           About GeneDecksing


    2 Pseudogenes.org Pseudogenes for PGGT1B
    PGOHUM00000238491 PGOHUM00000238555


    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD), the Human Cytochrome P450 Allele Nomenclature Database, and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers, Cancer Mutation PCR Arrays and Assays, and Copy Number PCR Arrays from QIAGEN)
    About This Section

    TryGeneCards Plus

    Selected SNPs for PGGT1B (see all 1036)    About this table    
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 5 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs794994821,2
    F--114546029(+) ATATTG/TCTTAT 1 -- ds50011Minor allele frequency- T:0.05WA 118
    rs1825157901,2
    --114546050(+) ATCGAC/TAAATG 1 -- ds50010--------
    rs1128518911,2
    F--114546112(+) TCACAC/ATGGGC 1 -- ds50012Minor allele frequency- A:0.06CSA WA 120
    rs171324801,2
    C,F,H--114546116(+) ACTGGG/CCTGCT 1 -- ds50018Minor allele frequency- C:0.02NA NS EA WA 562
    rs1420995231,2
    --114546134(+) GGTCAA/GTTCAG 1 -- ds50010--------
    rs2654201,2
    C,F,A,H--114546251(+) ATTATA/CAGGAG 1 -- ds500112Minor allele frequency- G:0.02EA NA NS WA CSA 567
    rs1872611231,2
    C--114546417(+) TATATA/TTGCTA 1 -- ds50010--------
    rs1905638531,2
    --114546497(+) TAGTAA/GCAACT 1 -- ds50010--------
    rs732534631,2
    C,F--114546634(+) AATAAT/GAAATC 1 -- ut312Minor allele frequency- G:0.04WA 120
    rs1831221441,2
    --114546695(+) ACAACA/CTTTTT 1 -- ut310--------

    HapMap Linkage Disequilibrium report for PGGT1B (114546527 - 114598569 bp)

    Structural Variations
         Database of Genomic Variants (DGV) 2 variations for PGGT1B:    About this table    
    Variant IDTypeSubtypePubMed ID
    nsv830453CNV Gain17160897
    nsv830454CNV Gain+Loss17160897

    Site Specific Mutation Identification with PCR Assays
    SeqTarget long-range PCR primers for resequencing PGGT1B
    DNA2.0 Custom Variant and Variant Library Synthesis for PGGT1B

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    TryGeneCards Plus
    OMIM gene information: 602031    OMIM disorders: --

    6 diseases for PGGT1B:    About MalaCards
    progeria    multiple sclerosis    colorectal cancer    prostate cancer
    prostatitis    malaria


    PGGT1B for disorders           About GeneDecksing

    Genetic Association Database (GAD): PGGT1B
    Human Genome Epidemiology (HuGE) Navigator: PGGT1B (1 document)

    Export disorders for PGGT1B gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    TryGeneCards Plus

    PubMed articles for PGGT1B gene, integrated from 10 sources (see all 27):
    (articles sorted by number of sources associating them with PGGT1B)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. cDNA cloning and expression of rat and human protein geranylgeranyltransferase type-I. (PubMed id 8106351)1, 2, 3 Zhang F.L....Omer C.A. (J. Biol. Chem. 1994)
    2. Genome-wide scan of 500,000 single-nucleotide polymorphisms among responders and nonresponders to interferon beta therapy in multiple sclerosis. (PubMed id 19667218)1, 4 Comabella M....Montalban X. (Arch. Neurol. 2009)
    3. Geranylgeranyltransferase I regulates HIF-1I+ promoting glioblastoma cell migration and invasion. (PubMed id 23475391)1 Zhou X....Yu R. (J. Neurooncol. 2013)
    4. Geranylgeranyl transferase 1 modulates autophagy and apoptosis in human airway smooth muscle. (PubMed id 22160308)1 Ghavami S....Halayko A.J. (Am. J. Physiol. Lung Cell Mol. Physiol. 2012)
    5. The global gene-expression profiles of U-937 human macrophages treated with Tat peptide and Tat-FITC conjugate. (PubMed id 22632162)1 Lin C.W....Jan M.S. (J Drug Target 2012)
    6. A high-throughput approach for measuring temporal changes in the interactome. (PubMed id 22863883)1 Kristensen A.R....Foster L.J. (Nat. Methods 2012)
    7. Initial characterization of the human central proteome. (PubMed id 21269460)2 Burkard T.R.... Colinge J. (BMC Syst. Biol. 2011)
    8. Systematic and quantitative assessment of the ubiquitin-modified proteome. (PubMed id 21906983)1 Kim W....Gygi S.P. (Mol. Cell 2011)
    9. Inhibition of GGTase-I and FTase disrupts cytoskeletal organization of human PC-3 prostate cancer cells. (PubMed id 20446922)1 Virtanen S.S....HAorkAPnen P.L. (Cell Biol. Int. 2010)
    10. Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer. (PubMed id 20403997)1 Lipkin S.M....Gruber S.B. (Cancer Prev Res (Phila) 2010)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section

    TryGeneCards Plus
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section

    TryGeneCards Plus
    Entrez Gene: 5229 HGNC: 8895 AceView: PGGT1B Ensembl:ENSG00000164219 euGenes: HUgn5229
    ECgene: PGGT1B H-InvDB: PGGT1B

    (According to HUGE)
    About This Section

    TryGeneCards Plus
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL, and/or others, e.g. Wikipedia and GeneReviews, via UniProtKB/Swiss-Prot)
    About This Section

    TryGeneCards Plus
    NameDescription
    PharmGKB entry for PGGT1B Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section

    TryGeneCards Plus
    Patent Information for PGGT1B gene:
    Search GeneIP for patents involving PGGT1B

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0. Clones from OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript, and ESI BIO, PCR Arrays from QIAGEN, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, Enzo Life Sciences, and/or ApexBio, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

    TryGeneCards Plus

     
     EMD Millipore genomic analysis products

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Enzyme Activity Assays/Reagents  
     Browse ELISpot/FluoroSpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Luminex Assays  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Recombinant/Natural Proteins   Browse Stem Cell Products  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     Browse OriGene Antibodies   OriGene RNAi products in human, mouse, rat for PGGT1B  
     Browse OriGene qPCR primer pairs and template standards   OriGene Protein Over-expression Lysate for PGGT1B  
     OriGene Custom Mass Spec   OriGene clones in human, mouse for PGGT1B  
     OriGene qSTAR qPCR primer pairs in human, mouse for PGGT1B   Browse OriGene full length recombinant human proteins expressed in human HEK293 cells  
     OriGene ORF clones in mouse, rat for PGGT1B   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for PGGT1B   OriGene Custom Protein Services for PGGT1B  

     
     
     Block miRNA regulation of human, mouse, rat PGGT1B using miScript Target Protectors SeqTarget long-range PCR primers for resequencing PGGT1B
     DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat PGGT1B Predesigned siRNA for gene silencing in human, mouse, rat PGGT1B
     QuantiFast Probe-based Assays in human, mouse, rat PGGT1B QuantiTect SYBR Green Assays in human, mouse, rat PGGT1B
     Custom PCR Arrays for PGGT1B Search Chromatin IP Primers for PGGT1B
     Pre-validated RT2 qPCR Primer Assay in human, mouse, rat PGGT1B  Search GeneGlobe Interaction Network for PGGT1B
     Regulatory tfbs in PGGT1B promoter
     GenScript Custom Purified and Recombinant Proteins Services for PGGT1B GenScript cDNA clones with any tag delivered in your preferred vector for PGGT1B
     GenScript Custom Assay Services for PGGT1B GenScript Custom overexpressing Cell Line Services for PGGT1B
     CloneReady with Over 120,000 Genes  Gene Synthesis: Any Gene in Any Vector
     Vector-based siRNA and miRNA, Ready for Transfection Gene Mutant Library, Variants up to 10^11
     Plasmid Preparation Custom Peptide Services
     Search for Antibodies & Assays

     Tocris compounds for PGGT1B
     Browse Sino Biological Proteins
     Browse Sino Biological Cell Lysates
     Browse Sino Biological cDNA Clones
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies

     Novus Tissue Slides
     PGGT1B antibodies
     PGGT1B proteins
     Antibodies for PGGT1B
     See all of Abcam's Antibodies, Kits and Proteins for PGGT1B
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins
     Browse Proteins at Cloud-Clone Corp.
     Browse Antibodies at Cloud-Clone Corp.
     Browse ELISAs at Cloud-Clone Corp.
     Browse CLIAs at Cloud-Clone Corp.



     Browse ESI BIO Cell Lines and PureStem Progenitors for PGGT1B
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for PGGT1B
     SwitchGear 3'UTR luciferase reporter plasmids for PGGT1B
     SwitchGear Promoter luciferase reporter plasmids for PGGT1B
     Search ThermoFisher Antibodies for PGGT1B
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PGGT1B
     inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for PGGT1B
     inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for PGGT1B
     LSBio Antibodies in human, mouse, rat for PGGT1B
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
     Browse compounds at ApexBio
           
    GeneCards Homepage - Last full update: 7 May 2014 - Incrementals: 9 May 2014 , 2 Jun 2014 , 26 Jun 2014 , 30 Jun 2014

    View Random Gene

    Category
    (GIFtS: )
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      PGGT1B gene at Home site.
    Version: 3.12.136 22 July 2014
    hostname: 356980-web2.xennexinc.com index build: 126 solr: 1.4