Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

PGGT1B Gene

protein-coding   GIFtS: 54
GCID: GC05M114575

protein geranylgeranyltransferase type I, beta subunit

 Explore 4 diseases affiliated with
PGGT1B via our new
 Human Malady Compendium 
Biological research products
for PGGT1B
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Protein Geranylgeranyltransferase Type I, Beta Subunit1 2     GGTase-I-Beta1
BGGI1 2     EC 2.5.1.593 8
GGTI1 2     Geranylgeranyl Transferase Type-1 Subunit Beta2
Geranylgeranyl Transferase Type I Subunit Beta2 3     Geranylgeranyltransferase Type I Beta Subunit2
Type I Protein Geranyl-Geranyltransferase Subunit Beta2 3     EC 2.5.18

External Ids:    HGNC: 88951   Entrez Gene: 52292   Ensembl: ENSG000001642197   OMIM: 6020315   UniProtKB: P536093   

Export aliases for PGGT1B gene to outside databases

Previous GC identifers: GC05M114151 GC05M114950 GC05M114578 GC05M114623 GC05M109728


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for PGGT1B:
Protein geranylgeranyltransferase type I (GGTase-I) transfers a geranylgeranyl group to the cysteine residue of
candidate proteins containing a C-terminal CAAX motif in which 'A' is an aliphatic amino acid and 'X' is leucine
(summarized by Zhang et al., 1994 (PubMed 8106351)). The enzyme is composed of a 48-kD alpha subunit (FNTA; MIM
134635) and a 43-kD beta subunit, encoded by the PGGT1B gene. The FNTA gene encodes the alpha subunit for both
GGTase-I and the related enzyme farnesyltransferase.(supplied by OMIM, Mar 2010)

UniProtKB/Swiss-Prot: PGTB1_HUMAN, P53609
Function: Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the
fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Acts on the
Rac1, Rac2, Rap1A and Rap1B proteins. The beta subunit is responsible for peptide-binding




(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000005.9  NC_018916.1  NT_034772.6  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the PGGT1B gene promoter:
         TBP   AML1a   HTF   Pax-6   Nkx2-2   E4BP4   FOXO4   FOXJ2 (long isoform)   STAT3   FOXJ2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidPGGT1B promoter sequence
   Search SABiosciences Chromatin IP Primers for PGGT1B

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat PGGT1B


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 5q22.3   Ensembl cytogenetic band:  5q22.3   HGNC cytogenetic band: 5q23.1

PGGT1B Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
PGGT1B gene location

GeneLoc information about chromosome 5         GeneLoc Exon Structure

GeneLoc location for GC05M114575:  view genomic region     (about GC identifiers)

Start:
114,546,527 bp from pter      End:
114,598,569 bp from pter
Size:
52,043 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: PGTB1_HUMAN, P53609 (See protein sequence)
Recommended Name: Geranylgeranyl transferase type-1 subunit beta  
Size: 377 amino acids; 42368 Da
Cofactor: Binds 1 zinc ion per subunit (By similarity)
Subunit: Heterodimer of an alpha and a beta subunit
Secondary accessions: Q5MJP9
Alternative splicing: 2 isoforms:  P53609-1   P53609-2   (No experimental confirmation available)

Explore the universe of human proteins at neXtProt for PGGT1B: NX_P53609

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_P53609

  • 3 DME Specific Peptides for PGGT1B (P53609)
     QLEDGSF  FGICGLSLM  YIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEE 

    PGGT1B Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins: NP_005014.2  
    ENSEMBL proteins: 
     ENSP00000404676   ENSP00000368935  

    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate: PGGT1B
    OriGene Custom Protein Services for PGGT1B 
    GenScript Custom Purified and Recombinant Proteins Services for PGGT1B
    Novus Biologicals PGGT1B Protein
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Browse Proteins at Uscn

    Gene Ontology (GO): 1 cellular component term (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005953CAAX-protein geranylgeranyltransferase complex IEA--


    PGGT1B for ontologies           About GeneDecksing



    PGGT1B Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for PGGT1B 
    GenScript Custom Superior Antibodies Services for PGGT1B
    Novus Biologicals PGGT1B Antibodies
    Search for Antibodies for PGGT1B at Abcam  
    Browse Antibodies at Uscn
    Search ThermoFisher Antibodies for PGGT1B

    Assay Products for PGGT1B: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for PGGT1B
    Browse Enzo Life Sciences for kits & assays
    Browse ELISAs and CLIAs at Uscn


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    PGGT1B for domains           About GeneDecksing

    2 InterPro domains/families:
     IPR008930 Terpenoid_cyclase/PrenylTrfase
     IPR001330 Prenyltrans

    Graphical View of Domain Structure for InterPro Entry P53609

    ProtoNet protein and cluster: P53609

    1 Blocks protein family: IPB001330 Prenyltransferase/squalene oxidase

    UniProtKB/Swiss-Prot: PGTB1_HUMAN, P53609
    Similarity: Belongs to the protein prenyltransferase subunit beta family
    Similarity: Contains 4 PFTB repeats


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: PGTB1_HUMAN, P53609
    Function: Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the
    fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Acts on the
    Rac1, Rac2, Rap1A and Rap1B proteins. The beta subunit is responsible for peptide-binding
    Catalytic activity: Geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate

    Enzyme Numbers (IUBMB): EC 2.5.1.591 2 EC 2.5.12

    miRNA
    Products:
        
    OriGene 3'-UTR Clone: PGGT1B
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat PGGT1B
    8/28 QIAGEN miScript miRNA Assays for microRNAs that regulate PGGT1B (see all 28):
    hsa-miR-579 hsa-miR-30c hsa-miR-892b hsa-miR-3146 hsa-miR-1271 hsa-miR-548v hsa-miR-30d hsa-miR-219-5p
    SwitchGear 3'UTR luciferase reporter plasmidPGGT1B 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for PGGT1B (see all 7)
    OriGene shRNA RFP: PGGT1B
    OriGene siRNA: PGGT1B
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat PGGT1B

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for PGGT1B

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for PGGT1B (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for PGGT1B
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: PGGT1B (NM_005023)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for PGGT1B
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PGGT1B 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for PGGT1B
    Search LifeMap BioReagents cell lines for PGGT1B

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for PGGT1B

    Gene Ontology (GO): 5/7 molecular function terms (GO ID links to tree view) (see all 7):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004662CAAX-protein geranylgeranyltransferase activity IEA--
    GO:0005515protein binding ----
    GO:0008144drug binding ----
    GO:0008270zinc ion binding ----
    GO:0019840isoprenoid binding ----


    PGGT1B for ontologies           About GeneDecksing


    Animal Models:
         Mouse knock-out Pggt1btm1.1Mbrg for PGGT1B
         9 MGI mutant phenotypes (inferred from 2 alleles(MGI details for Pggt1b):
     cellular  growth/size  hematopoietic system  immune system  integument 
     liver/biliary system  mortality/aging  respiratory system  tumorigenesis 

    PGGT1B for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways  About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1G-protein signaling_RhoA regulation pathway
    G-protein signaling RhoA regulation pathway1.00
    G-protein signaling RhoB regulation pathway0.16
    G-protein signaling_RhoA regulation pathway1.00
    G-protein signaling_Rap2B regulation pathway0.04
    G-protein signaling_RhoB regulation pathway0.16
    G-protein signaling Rap2B regulation pathway0.04
    2G-protein signaling Rap1A regulation pathway
    G-protein signaling Rap1A regulation pathway1.00
    G-protein signaling_Rap1B regulation pathway0.21
    G-protein signaling_Rap1A regulation pathway0.88
    G-protein signaling Rap1B regulation pathway0.21
    3G-protein signaling Regulation of RAC1 activity
    G-protein signaling Regulation of RAC1 activity1.00
    G-protein signaling_Rac2 regulation pathway0.16
    G-protein signaling_Regulation of RAC1 activity0.88
    G-protein signaling Rac2 regulation pathway0.16
    4Cytoskeleton remodeling_RalB regulation pathway
    Cytoskeleton remodeling RalA regulation pathway0.23
    Cytoskeleton remodeling_RalA regulation pathway0.23

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    5/8 EMD Millipore Pathways for PGGT1B (see all 8)
        G-protein signaling Rac2 regulation pathway
    G-protein signaling RhoB regulation pathway
    G-protein signaling RhoA regulation pathway
    G-protein signaling Rap1B regulation pathway
    G-protein signaling Rap2B regulation pathway


    5/8 GeneGo (Thomson Reuters) Pathways for PGGT1B (see all 8)
        G-protein signaling Regulation of RAC1 activity
    G-protein signaling Rap1A regulation pathway
    G-protein signaling Rac2 regulation pathway
    G-protein signaling Rap2B regulation pathway
    G-protein signaling RhoB regulation pathway



    PGGT1B for pathways           About GeneDecksing

    Interactions:

        Search SABiosciences Gene Network CentralTM Interacting Genes and Proteins Networks for PGGT1B

    STRING Interaction Network Preview (showing 5 interactants - click image to see 7)

    5/10 Interacting proteins for PGGT1B (P536093 ENSP000004046764) via UniProtKB, MINT, STRING, and/or I2D (see all 10)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    FNTAP493543, ENSP000003034234I2D: score=2 STRING: ENSP00000303423
    RHOBP627453, ENSP000002722334I2D: score=1 STRING: ENSP00000272233
    CDC42P609533, ENSP000003144584I2D: score=1 STRING: ENSP00000314458
    GNG2P597683, ENSP000003344484I2D: score=1 STRING: ENSP00000334448
    KRASP011163, ENSP000002560784I2D: score=1 STRING: ENSP00000256078
    About this table

    Gene Ontology (GO): 5/6 biological process terms (GO ID links to tree view) (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0008284positive regulation of cell proliferation IEA--
    GO:0018344protein geranylgeranylation TAS8106351
    GO:0034097response to cytokine stimulus IEA--
    GO:0045787positive regulation of cell cycle IEA--
    GO:0051771negative regulation of nitric-oxide synthase biosynthetic process IEA--


    PGGT1B for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section
    EMD Millipore small molecules for PGGT1B:
    Small Molecule - inhibitor
    Browse drugs & compounds from Enzo Life Sciences

    Compounds for PGGT1B available from Tocris Bioscience    About this table
    CompoundAction CAS #
    GliotoxinImmunosuppressant; inhibits NF-kappaB and cytokine production[67-99-2]

    1 HMDB Compound for PGGT1B    About this table
    CompoundSynonyms CAS #PubMed Ids
    Pravastatin3beta-Hydroxycompactin (see all 7)81093-37-0--

    3 DrugBank Compounds for PGGT1B    About this table
    CompoundSynonyms CAS #TypeActionsPubMed Ids
    2-[METHYL-(5-GERANYL-4-METHYL-PENT-3-ENYL)-AMINO]-ETHYL-DIPHOSPHATE-- --target--10592235
    4-[(5-{[4-(3-CHLOROPHENYL)-3-OXOPIPERAZIN-1-YL]METHYL}-1H-IMIDAZOL-1-YL)METHYL]BENZONITRILE-- --target--10592235
    GERANYLGERANYL DIPHOSPHATE-- --target--10592235

    Search CenterWatch for drugs/clinical trials and news about PGGT1B / PGTB1 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for PGGT1B gene: 
    NM_005023.3  

    Unigene Cluster for PGGT1B:

    Protein geranylgeranyltransferase type I, beta subunit
    Hs.254006  [show with all ESTs]
    Unigene Representative Sequence: NM_005023
    5 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000419445(uc003kqw.4 uc010jch.3) ENST00000379615 ENST00000514178
    ENST00000296642 ENST00000503638

    miRNA
    Products:
         
    OriGene 3'-UTR Clone: PGGT1B
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat PGGT1B
    8/28 QIAGEN miScript miRNA Assays for microRNAs that regulate PGGT1B (see all 28):
    hsa-miR-579 hsa-miR-30c hsa-miR-892b hsa-miR-3146 hsa-miR-1271 hsa-miR-548v hsa-miR-30d hsa-miR-219-5p
    SwitchGear 3'UTR luciferase reporter plasmidPGGT1B 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for PGGT1B (see all 7)
    OriGene shRNA RFP: PGGT1B
    OriGene siRNA: PGGT1B
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat PGGT1B
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for PGGT1B (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for PGGT1B
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: PGGT1B (NM_005023)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for PGGT1B
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PGGT1B 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for PGGT1B
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat PGGT1B
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat PGGT1B
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat PGGT1B

    Additional cDNA sequence: AY780790.1 

    5 DOTS entries:

    DT.453258  DT.97790688  DT.92458575  DT.70105048  DT.106872 

    24/41 AceView cDNA sequences (see all 41):

    AA789108 CR591401 AA281562 CK904573 AA961272 AA989220 AW779540 AI435086 
    BX113067 CK904574 AU122784 BU607890 BU633729 AI348055 AI540086 BM054888 
    NM_005023 AL520656 BM979607 AA285159 AL520655 AI911308 BU674247 AI284958 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    PGGT1B expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: CTTAGTTTTA

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image
    See PGGT1B Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for PGGT1B

    SOURCE GeneReport for Unigene cluster: Hs.254006
        SABiosciences Custom PCR Arrays for PGGT1B
    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for PGGT1B
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat PGGT1B
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat PGGT1B
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat PGGT1B
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for PGGT1B

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of eukaryotes.

    Orthologs for PGGT1B gene from 9/27 species (see all 27)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Pggt1b1 , 5 protein geranylgeranyltransferase type I, beta subunit1, 5 87.18(n)1
    96.82(a)1
      18 (24.45 cM)5
    2254671  NM_172627.31  NP_766215.11 
     462399495 
    chicken
    (Gallus gallus)
    Aves PGGT1B1 protein geranylgeranyltransferase type I, beta subunit 82.14(n)
    91.46(a)
      770633  XM_003643102.1  XP_003643150.1 
    lizard
    (Anolis carolinensis)
    Reptilia PGGT1B6
    --
    89(a)
    1 ↔ 1
    GL343193.1(8135988-8167424)
    African clawed frog
    (Xenopus laevis)
    Amphibia Xl.44542 Xenopus laevis transcribed sequence with moderate similarity more 78.61(n)    CA980858.1 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.106512 Transcribed sequence with moderate similarity to protein more 72.88(n)    CA476901.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta &bgr;ggt-I3
    betaggt-I1
    RAS protein signal transduction CAAX-protein
    geranylgeranyltransferase3
    beta subunit of type I geranylgeranyl transferase1
    44(a)3
    51.18(n)1
    45.33(a)1
      2 25B43
    337041  NM_080361.21  NP_525100.21 
    worm
    (Caenorhabditis elegans)
    Secernentea csp-13
    Y48E1B.31
    C14 peptidase3
    Protein Y48E1B.31
    40(a)3
    50.89(n)1
    44.38(a)1
      II(13547827-13567858)3
    1749991  NM_064447.41  NP_496848.11 
    thale cress
    (Arabidopsis thaliana)
    eudicotyledons PGGT-I1 geranylgeranyl transferase type-1 subunit beta 51.04(n)
    41.93(a)
      818540  NM_129513.3  NP_181487.1 
    rice
    (Oryza sativa)
    Liliopsida Os01g01501001 hypothetical protein 52.67(n)
    43.21(a)
      4324517  NM_001048566.1  NP_001042031.1 


    ENSEMBL Gene Tree for PGGT1B (if available)
    TreeFam Gene Tree for PGGT1B (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for PGGT1B gene
    RABGGTB2  

    PGGT1B for paralogs           About GeneDecksing


    2 Pseudogenes.org Pseudogenes for PGGT1B
    PGOHUM00000238491 PGOHUM00000238555


    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/875 NCBI SNPs in PGGT1B are shown (see all 875    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 5 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs794994821,2
    F,--114546029(+) ATATTG/TCTTAT 1 -- ds50011Minor allele frequency- T:0.05WA 118
    rs1825157901,2
    --114546050(+) ATCGAC/TAAATG 1 -- ds50010--------
    rs1128518911,2
    --114546112(+) TCACAC/ATGGGC 1 -- ds50012Minor allele frequency- A:0.06CSA WA 120
    rs171324801,2
    C,F,H,--114546116(+) ACTGGG/CCTGCT 1 -- ds50018Minor allele frequency- C:0.02NA NS EA WA 562
    rs1420995231,2
    --114546134(+) GGTCAA/GTTCAG 1 -- ds50010--------
    rs2654201,2
    C,F,A,H,--114546251(+) ATTATA/CAGGAG 1 -- ds500112Minor allele frequency- G:0.02EA NA NS WA CSA 567
    rs1872611231,2
    --114546417(+) TATATA/TTGCTA 1 -- ds50010--------
    rs1905638531,2
    --114546497(+) TAGTAA/GCAACT 1 -- ds50010--------
    rs732534631,2
    C,--114546634(+) AATAAT/GAAATC 1 -- ut312Minor allele frequency- G:0.04WA 120
    rs1831221441,2
    --114546695(+) ACAACA/CTTTTT 1 -- ut310--------

    HapMap Linkage Disequilibrium report for PGGT1B (114546527 - 114598569 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
    Database of Genomic Variants (DGV): 1 variation for PGGT1B
         1 CNV: 4473

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing PGGT1B
    DNA2.0 Custom Variant and Variant Library Synthesis for PGGT1B

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    PGGT1B for disorders           About GeneDecksing

    OMIM gene information: 602031    OMIM disorders: --

    4 diseases for PGGT1B:    About MalaCards
    progeria    colorectal cancer    prostate cancer    prostatitis

    Human Genome Epidemiology (HuGE) Navigator: PGGT1B (1 document)

    Export disorders for PGGT1B gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for PGGT1B gene, integrated from 9 sources (see all 25):
    (articles sorted by number of sources associating them with PGGT1B)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. cDNA cloning and expression of rat and human protein geranylgeranyltransferase type-I. (PubMed id 8106351)1, 2, 3 Zhang F.L....Omer C.A. (1994)
    2. Geranylgeranyl transferase 1 modulates autophagy and a poptosis in human airway smooth muscle. (PubMed id 22160308)1 Ghavami S....Halayko A.J. (2012)
    3. The global gene-expression profiles of U-937 human mac rophages treated with Tat peptide and Tat-FITC conjugate. (PubMed id 22632162)1 Lin C.W....Jan M.S. (2012)
    4. A high-throughput approach for measuring temporal chan ges in the interactome. (PubMed id 22863883)1 Kristensen A.R....Foster L.J. (2012)
    5. Initial characterization of the human central proteome. (PubMed id 21269460)2 Burkard T.R.... Colinge J. (2011)
    6. Systematic and quantitative assessment of the ubiquiti n-modified proteome. (PubMed id 21906983)1 Kim W....Gygi S.P. (2011)
    7. Inhibition of GGTase-I and FTase disrupts cytoskeleta l organization of human PC-3 prostate cancer cells. (PubMed id 20446922)1 Virtanen S.S....HAorkAPnen P.L. (2010)
    8. Genetic variation in 3-hydroxy-3-methylglutaryl CoA r eductase modifies the chemopreventive activity of statins for colorectal cancer . (PubMed id 20403997)1 Lipkin S.M....Gruber S.B. (2010)
    9. Genome-wide scan of 500,000 single-nucleotide polymor phisms among responders and nonresponders to interferon beta therapy in multipl e sclerosis. (PubMed id 19667218)1 Comabella M....Montalban X. (2009)
    10. Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. (PubMed id 16344560)1 Kimura K.... Sugano S. (2006)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 5229 HGNC: 8895 AceView: PGGT1B Ensembl:ENSG00000164219 euGenes: HUgn5229
    ECgene: PGGT1B H-InvDB: PGGT1B

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for PGGT1B Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for PGGT1B gene:
    Search GeneIP for patents involving PGGT1B

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     Browse Purified and Recombinant Proteins at EMD Millipore
     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
     Browse Kits and Assays available from EMD Millipore
     EMD Millipore small molecules (inhibitor) for PGGT1B
     Browse for Gene Knock-down Tools from EMD Millipore
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     Browse OriGene Antibodies   OriGene shRNA RFP for PGGT1B  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for PGGT1B   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for PGGT1B  
     OriGene Protein Over-expression Lysate for PGGT1B   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for PGGT1B   OriGene 3'-UTR Clone for PGGT1B  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for PGGT1B   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for PGGT1B  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for PGGT1B   OriGene Custom Protein Services for PGGT1B  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat PGGT1B
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing PGGT1B
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat PGGT1B
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat PGGT1B
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat PGGT1B
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat PGGT1B
     GenScript Custom Purified and Recombinant Proteins Services for PGGT1B GenScript cDNA clones with any tag delivered in your preferred vector for PGGT1B
     GenScript Custom Assay Services for PGGT1B GenScript Custom Superior Antibodies Services for PGGT1B
     GenScript Custom overexpressing Cell Line Services for PGGT1B CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in PGGT1B promoter
     Search Chromatin IP Primers for PGGT1B
     RT2 qPCR Primer Assay in human, mouse, rat PGGT1B
     Search GNC Networks for PGGT1B
     SABiosciences Custom PCR Arrays for PGGT1B
     Tocris compounds for PGGT1B
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     PGGT1B antibodies
     PGGT1B proteins
     Search for Antibodies for PGGT1B at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for PGGT1B
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     Browse ELISAs, CLIAs, Proteins, and Antibodies at Uscn
     Search LifeMap BioReagents cell lines for PGGT1B
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for PGGT1B
     SwitchGear 3'UTR luciferase reporter plasmids for PGGT1B
     SwitchGear Promoter luciferase reporter plasmids for PGGT1B
     Search ThermoFisher Antibodies for PGGT1B
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat PGGT1B
           
    GeneCards Homepage - Last full update: 19 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      PGGT1B gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 100 solr: 1.4