Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PGC Gene

Aliases for PGC Gene

  • Progastricsin 2 3 5
  • Pepsinogen C 2 3 4
  • EC 3.4.23.3 4 61
  • Progastricsin (Pepsinogen C) 2
  • Pepsinogen Group II 3
  • Preprogastricsin 3
  • Gastricsin 3
  • EC 3.4.23 61
  • Pepsin C 3
  • PGII 3
  • PEPC 3

External Ids for PGC Gene

Previous GeneCards Identifiers for PGC Gene

  • GC06M041706
  • GC06M041751
  • GC06M041813
  • GC06M041704
  • GC06M041423

Summaries for PGC Gene

Entrez Gene Summary for PGC Gene

  • This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the serum. This protein is synthesized as an inactive zymogen that includes a highly basic prosegment. This enzyme is converted into its active mature form at low pH by sequential cleavage of the prosegment that is carried out by the enzyme itself. Polymorphisms in this gene are associated with susceptibility to gastric cancers. Serum levels of this enzyme are used as a biomarker for certain gastric diseases including Helicobacter pylori related gastritis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1. [provided by RefSeq, Oct 2009]

GeneCards Summary for PGC Gene

PGC (Progastricsin) is a Protein Coding gene. Diseases associated with PGC include Gastritis and Atrophic Gastritis. GO annotations related to this gene include aspartic-type endopeptidase activity. An important paralog of this gene is PGA3.

UniProtKB/Swiss-Prot for PGC Gene

  • Hydrolyzes a variety of proteins.

Gene Wiki entry for PGC Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PGC Gene

Genomics for PGC Gene

Regulatory Elements for PGC Gene

Enhancers for PGC Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH06F041703 1.6 FANTOM5 Ensembl ENCODE 12.7 +47.7 47711 5.6 HDGF PKNOX1 WRNIP1 SIN3A ARID4B ZNF48 ZNF2 ZNF143 ZNF207 FOS TFEB PGC UBR2 MDFI TREML3P PRICKLE4 TREM1 GC06M041707 GC06M041708 GC06P041713
GH06F041718 1.5 FANTOM5 ENCODE 11.7 +26.6 26611 17.5 HDGF PKNOX1 CREB3L1 MLX WRNIP1 ARID4B SIN3A YBX1 DMAP1 ZNF207 PGC TFEB PRICKLE4 ENSG00000231102
GH06F041711 1.3 Ensembl ENCODE 12.7 +40.6 40630 3.8 HDGF ARNT ARID4B ZNF2 ZNF48 YY1 GLIS2 ZNF143 FOS KDM4B TFEB PGC MDFI GC06P041713 GC06M041707 GC06M041708
GH06F041715 1.2 Ensembl ENCODE 12.7 +37.0 37009 2.6 HDGF ARID4B ZNF2 ZNF48 GLIS2 ZNF143 FOS SP5 REST KAT8 PGC MDFI PRICKLE4 TFEB ENSG00000231102 GC06P041713
GH06F041776 1 ENCODE 11.8 -22.0 -21989 0.2 HDGF WRNIP1 ARID4B SLC30A9 ZNF143 MXD4 MIER2 REST KAT8 SSRP1 PGC TFEB ENSG00000231102 CCND3 TAF8 BYSL ENSG00000207371 MED20 RNU6-761P PRICKLE4
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PGC on UCSC Golden Path with GeneCards custom track

Genomic Location for PGC Gene

Chromosome:
6
Start:
41,736,711 bp from pter
End:
41,754,109 bp from pter
Size:
17,399 bases
Orientation:
Minus strand

Genomic View for PGC Gene

Genes around PGC on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PGC Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PGC Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PGC Gene

Proteins for PGC Gene

  • Protein details for PGC Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P20142-PEPC_HUMAN
    Recommended name:
    Gastricsin
    Protein Accession:
    P20142
    Secondary Accessions:
    • B4DVZ3
    • Q5T3D7
    • Q5T3D8

    Protein attributes for PGC Gene

    Size:
    388 amino acids
    Molecular mass:
    42426 Da
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=AAA60062.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for PGC Gene

    Alternative splice isoforms for PGC Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PGC Gene

Selected DME Specific Peptides for PGC Gene

P20142:
  • GGVDSSLYTG
  • QEGALTSP
  • DTGSSNLW
  • SLYTGQI
  • WILGDVF
  • VVKVPLKK
  • SSTYSTNGQTFSLQYGSGSLTGFFGYDT
  • NNRVGFA
  • RVGFATA
  • YFGEISIGTP
  • YFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACT
  • PVTQELYWQI
  • ISIGTPP
  • AIVDTGTSL
  • KSIRETMKE
  • ILGDVFL
  • LWVPSVYC
  • VPQQYMSA
  • GTPPQNF

Post-translational modifications for PGC Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for PGC Gene

Domains & Families for PGC Gene

Suggested Antigen Peptide Sequences for PGC Gene

Graphical View of Domain Structure for InterPro Entry

P20142

UniProtKB/Swiss-Prot:

PEPC_HUMAN :
  • Contains 1 peptidase A1 domain.
  • Belongs to the peptidase A1 family.
Domain:
  • Contains 1 peptidase A1 domain.
Family:
  • Belongs to the peptidase A1 family.
genes like me logo Genes that share domains with PGC: view

No data available for Gene Families for PGC Gene

Function for PGC Gene

Molecular function for PGC Gene

GENATLAS Biochemistry:
progastricsin (pepsinogen C)
UniProtKB/Swiss-Prot CatalyticActivity:
More restricted specificity than pepsin A, but shows preferential cleavage at Tyr- -Xaa bonds. High activity on hemoglobin.
UniProtKB/Swiss-Prot Function:
Hydrolyzes a variety of proteins.

Enzyme Numbers (IUBMB) for PGC Gene

Gene Ontology (GO) - Molecular Function for PGC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004190 aspartic-type endopeptidase activity IMP 12759353
GO:0008233 peptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with PGC: view
genes like me logo Genes that share phenotypes with PGC: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PGC

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for PGC Gene

Localization for PGC Gene

Subcellular locations from UniProtKB/Swiss-Prot for PGC Gene

Secreted.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PGC gene
Compartment Confidence
extracellular 5
nucleus 3
plasma membrane 2
mitochondrion 2
cytosol 2
lysosome 2
golgi apparatus 1

Gene Ontology (GO) - Cellular Components for PGC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region IEA --
GO:0005615 extracellular space IDA 12759353
GO:0070062 extracellular exosome IDA 23376485
genes like me logo Genes that share ontologies with PGC: view

Pathways & Interactions for PGC Gene

No Data Available

Gene Ontology (GO) - Biological Process for PGC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0002803 positive regulation of antibacterial peptide production IMP 12759353
GO:0006508 proteolysis IEA --
GO:0007586 digestion IEA --
GO:0030163 protein catabolic process IBA --
genes like me logo Genes that share ontologies with PGC: view

No data available for Pathways by source and SIGNOR curated interactions for PGC Gene

Drugs & Compounds for PGC Gene

(1) Drugs for PGC Gene - From: DGIdb

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Ecabet Approved, Investigational Pharma 5

(1) Additional Compounds for PGC Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with PGC: view

Transcripts for PGC Gene

Unigene Clusters for PGC Gene

Progastricsin (pepsinogen C):
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for PGC Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9
SP1:
SP2: - -

Relevant External Links for PGC Gene

GeneLoc Exon Structure for
PGC
ECgene alternative splicing isoforms for
PGC

Expression for PGC Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PGC Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for PGC Gene

This gene is overexpressed in Stomach (x51.9).

Protein differential expression in normal tissues from HIPED for PGC Gene

This gene is overexpressed in Stomach (49.9) and Cardia (15.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PGC Gene



NURSA nuclear receptor signaling pathways regulating expression of PGC Gene:

PGC

SOURCE GeneReport for Unigene cluster for PGC Gene:

Hs.1867
genes like me logo Genes that share expression patterns with PGC: view

No data available for Protein tissue co-expression partners and mRNA Expression by UniProt/SwissProt for PGC Gene

Orthologs for PGC Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for PGC Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PGC 34 35
  • 99.57 (n)
cow
(Bos Taurus)
Mammalia PGC 34 35
  • 86.56 (n)
oppossum
(Monodelphis domestica)
Mammalia PGC 35
  • 80 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Pgc 34
  • 79.98 (n)
mouse
(Mus musculus)
Mammalia Pgc 34 16 35
  • 78.87 (n)
dog
(Canis familiaris)
Mammalia PGC 35
  • 61 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia PGC 35
  • 44 (a)
OneToOne
chicken
(Gallus gallus)
Aves PGC 34 35
  • 71.25 (n)
lizard
(Anolis carolinensis)
Reptilia PGC 35
  • 73 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia LOC496913 34
  • 66.85 (n)
African clawed frog
(Xenopus laevis)
Amphibia pgc-A 34
fruit fly
(Drosophila melanogaster)
Insecta CG13095 36
  • 43 (a)
CG17134 36
  • 43 (a)
CG6508 36
  • 42 (a)
pcl 36
  • 41 (a)
CG10104 36
  • 39 (a)
CG5860 36
  • 37 (a)
CG17283 36
  • 35 (a)
worm
(Caenorhabditis elegans)
Secernentea asp-2 36
  • 34 (a)
C11D2.2 36
  • 34 (a)
Y39B6A.23 36
  • 34 (a)
asp-6 36
  • 33 (a)
F21F8.4 36
  • 33 (a)
asp-5 36
  • 32 (a)
Y39B6A.21 36
  • 32 (a)
Y39B6A.24 36
  • 32 (a)
C15C8.3 36
  • 31 (a)
F28A12.4 36
  • 31 (a)
F59D6.2 36
  • 31 (a)
Y39B6A.22 36
  • 31 (a)
F59D6.3 36
  • 30 (a)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_ACR144W 34
  • 50.75 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes YPS3 37
Species where no ortholog for PGC was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • zebrafish (Danio rerio)

Evolution for PGC Gene

ENSEMBL:
Gene Tree for PGC (if available)
TreeFam:
Gene Tree for PGC (if available)

Paralogs for PGC Gene

Paralogs for PGC Gene

(7) SIMAP similar genes for PGC Gene using alignment to 3 proteins:

Pseudogenes.org Pseudogenes for PGC Gene

genes like me logo Genes that share paralogs with PGC: view

Variants for PGC Gene

Sequence variations from dbSNP and Humsavar for PGC Gene

SNP ID Clin Chr 06 pos Sequence Context AA Info Type
rs10536839 -- 41,738,189(+) atata(-/TG)catat intron-variant, upstream-variant-2KB
rs10542589 -- 41,744,990(+) GTCTG(-/TC)TCTCT intron-variant
rs10557593 -- 41,738,236(+) TATAT(-/AT)GTATA intron-variant, upstream-variant-2KB
rs10557594 -- 41,738,265(+) ATATG(-/CA)CACAC intron-variant
rs10595601 -- 41,738,212(+) tatat(-/AT)gcata intron-variant, upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for PGC Gene

Variant ID Type Subtype PubMed ID
nsv602988 CNV loss 21841781
esv2731978 CNV deletion 23290073
esv2731977 CNV deletion 23290073
esv2211967 CNV deletion 18987734
dgv10637n54 CNV gain 21841781

Variation tolerance for PGC Gene

Residual Variation Intolerance Score: 46.2% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.05; 21.42% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PGC Gene

Human Gene Mutation Database (HGMD)
PGC
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PGC

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PGC Gene

Disorders for PGC Gene

MalaCards: The human disease database

(6) MalaCards diseases for PGC Gene - From: DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
gastritis
  • acute gastric mucosal erosion
atrophic gastritis
  • gastric atrophy
lymphocele
  • lymph cyst
dyspepsia
  • dyspepsia, indigestion nos
peptic esophagitis
  • esophagitis or esophageal reflux
- elite association - COSMIC cancer census association via MalaCards
Search PGC in MalaCards View complete list of genes associated with diseases

Relevant External Links for PGC

Genetic Association Database (GAD)
PGC
Human Genome Epidemiology (HuGE) Navigator
PGC
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PGC
genes like me logo Genes that share disorders with PGC: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PGC Gene

Publications for PGC Gene

  1. Structural characterization of activation 'intermediate 2' on the pathway to human gastricsin. (PMID: 9406551) Khan A.R. … James M.N. (Nat. Struct. Biol. 1997) 3 4 22 64
  2. Crystal and molecular structures of human progastricsin at 1.62-A resolution. (PMID: 7714902) Moore S.A. … James M.N.G. (J. Mol. Biol. 1995) 3 4 22 64
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  4. Impact of pepsinogen C polymorphism on individual susceptibility to gastric cancer and its precancerous conditions in a Northeast Chinese population. (PMID: 19132389) Sun L.P. … Yuan Y. (J. Cancer Res. Clin. Oncol. 2009) 3 46 64
  5. [Correlation of pepsinogen C (PGC) gene insertion/deletion polymorphism to PGC protein expression in gastric mucosa and serum]. (PMID: 19624876) Sun L.P. … Yuan Y. (Ai Zheng 2009) 3 46 64

Products for PGC Gene

Sources for PGC Gene

Content
Loading form....