Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PDE2A Gene

Aliases for PDE2A Gene

  • Phosphodiesterase 2A 2 3 5
  • Cyclic GMP-Stimulated Phosphodiesterase 3 4
  • Phosphodiesterase 2A, CGMP-Stimulated 2 3
  • EC 3.1.4.17 4 58
  • CGS-PDE 3 4
  • CGSPDE 3 4
  • CGMP-Dependent 3,5-Cyclic Phosphodiesterase 3
  • CGMP-Stimulated Phosphodiesterase 1 3
  • CGMP-Stimulated Phosphodiesterase 2 3
  • CGMP-Stimulated Phosphodiesterase 4 3
  • EC 3.1.4 58
  • PDE2A1 3
  • PED2A4 3

External Ids for PDE2A Gene

Previous GeneCards Identifiers for PDE2A Gene

  • GC11M074619
  • GC11M073826
  • GC11M072509
  • GC11M072013
  • GC11M071964
  • GC11M072287
  • GC11M068580

Summaries for PDE2A Gene

GeneCards Summary for PDE2A Gene

PDE2A (Phosphodiesterase 2A) is a Protein Coding gene. Diseases associated with PDE2A include Retinitis Pigmentosa. Among its related pathways are G alpha (s) signalling events and Response to elevated platelet cytosolic Ca2+. GO annotations related to this gene include protein homodimerization activity and calcium channel activity. An important paralog of this gene is PDE11A.

UniProtKB/Swiss-Prot for PDE2A Gene

  • Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.

  • Isoform PDE2A2: Regulates Mitochondrial cAMP Levels and Respiration.

Tocris Summary for PDE2A Gene

  • Phosphodiesterases (PDEs) are a family of phosphohydrolyases that catalyze the hydrolysis of 3' cyclic phosphate bonds in adenosine and/or guanine 3',5' cyclic monophosphate (cAMP and/or cGMP). PDEs regulate the second messengers by controlling their degradation.

Gene Wiki entry for PDE2A Gene

Additional gene information for PDE2A Gene

No data available for Entrez Gene Summary , CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PDE2A Gene

Genomics for PDE2A Gene

Regulatory Elements for PDE2A Gene

Enhancers for PDE2A Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH11H072624 1.6 FANTOM5 Ensembl ENCODE dbSUPER 17.9 +48.3 48323 3 ELF3 DRAP1 FOXA2 SAP130 MLX JUN ZFP64 ARID4B MAX RARA PDE2A ARAP1-AS1 ARAP1 P2RY6 RELT GC11P072622 LOC105369379
GH11H072628 1.7 FANTOM5 Ensembl ENCODE dbSUPER 10.9 +42.2 42195 7 ATF1 NFRKB NFXL1 TCF12 EGR1 RCOR1 CREM ZBTB2 CEBPB NCOA1 PDE2A RELT GC11P072622 LOC105369379
GH11H072762 1.6 FANTOM5 ENCODE dbSUPER 10.6 -90.7 -90721 5 PKNOX1 FOXA2 MLX ARID4B DMAP1 RUNX3 SP5 MXD4 REST PPARG ARAP1 STARD10 ATG16L2 RPS12P20 ARAP1-AS2 PDE2A ARAP1-AS1 RNU6-672P GC11P072768 PIR40050
GH11H072757 1.5 Ensembl ENCODE dbSUPER 10.3 -84.3 -84282 1 HDGF PKNOX1 ATF1 ARNT GLI4 GLIS2 FOS ATF7 NCOA1 REST ARAP1 STARD10 RPS12P20 ARAP1-AS2 ATG16L2 ARAP1-AS1 PDE2A RNU6-672P PIR40050 GC11P072768
GH11H072652 0.9 ENCODE dbSUPER 12.2 +21.5 21510 0 HDAC1 MXI1 RFX1 HDAC2 POLR2A MAX ZSCAN29 KDM1A ZEB2 ARAP1 PDE2A MIR139 ARAP1-AS1 RNU7-105P LOC105369379
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PDE2A on UCSC Golden Path with GeneCards custom track

Genomic Location for PDE2A Gene

Chromosome:
11
Start:
72,576,140 bp from pter
End:
72,674,591 bp from pter
Size:
98,452 bases
Orientation:
Minus strand

Genomic View for PDE2A Gene

Genes around PDE2A on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PDE2A Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PDE2A Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PDE2A Gene

Proteins for PDE2A Gene

  • Protein details for PDE2A Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O00408-PDE2A_HUMAN
    Recommended name:
    cGMP-dependent 3,5-cyclic phosphodiesterase
    Protein Accession:
    O00408
    Secondary Accessions:
    • B2R646
    • B3KRV5
    • E9PGI1
    • F6W5Z0
    • Q5J791
    • Q5J792
    • Q5J793
    • Q6ZMR1

    Protein attributes for PDE2A Gene

    Size:
    941 amino acids
    Molecular mass:
    105717 Da
    Cofactor:
    Name=a divalent metal cation; Xref=ChEBI:CHEBI:60240;
    Quaternary structure:
    • Homodimer.
    Miscellaneous:
    • cGMP binds at an allosteric activator site.
    SequenceCaution:
    • Sequence=AAS75515.1; Type=Frameshift; Positions=48; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for PDE2A Gene

    Alternative splice isoforms for PDE2A Gene

neXtProt entry for PDE2A Gene

Selected DME Specific Peptides for PDE2A Gene

O00408:
  • ERHHFAQ
  • HDLDHRG
  • EIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGS
  • SVMERHHF
  • ISCMCHDL

Post-translational modifications for PDE2A Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for PDE2A Gene

Gene Families for PDE2A Gene

HGNC:
IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins
  • Predicted secreted proteins

Protein Domains for PDE2A Gene

Graphical View of Domain Structure for InterPro Entry

O00408

UniProtKB/Swiss-Prot:

PDE2A_HUMAN :
  • GAF 1 functions as a dimerization domain, whereas GAF 2 binds cGMP, which causes activation of the catalytic activity of the enzyme.
  • Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily.
Domain:
  • GAF 1 functions as a dimerization domain, whereas GAF 2 binds cGMP, which causes activation of the catalytic activity of the enzyme.
Family:
  • Belongs to the cyclic nucleotide phosphodiesterase family. PDE2 subfamily.
genes like me logo Genes that share domains with PDE2A: view

Function for PDE2A Gene

Molecular function for PDE2A Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Nucleoside 3,5-cyclic phosphate + H(2)O = nucleoside 5-phosphate.
UniProtKB/Swiss-Prot Function:
Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes.
UniProtKB/Swiss-Prot Function:
Isoform PDE2A2: Regulates Mitochondrial cAMP Levels and Respiration.

Enzyme Numbers (IUBMB) for PDE2A Gene

Phenotypes From GWAS Catalog for PDE2A Gene

Gene Ontology (GO) - Molecular Function for PDE2A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000166 nucleotide binding IEA --
GO:0004112 cyclic-nucleotide phosphodiesterase activity IDA 15938621
GO:0004114 3,5-cyclic-nucleotide phosphodiesterase activity IEA --
GO:0004115 3,5-cyclic-AMP phosphodiesterase activity TAS --
GO:0004118 cGMP-stimulated cyclic-nucleotide phosphodiesterase activity IDA,TAS 17329248
genes like me logo Genes that share ontologies with PDE2A: view
genes like me logo Genes that share phenotypes with PDE2A: view

Animal Models for PDE2A Gene

MGI Knock Outs for PDE2A:

Animal Model Products

  • Taconic Biosciences Mouse Models for PDE2A

CRISPR Products

miRNA for PDE2A Gene

miRTarBase miRNAs that target PDE2A

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PDE2A
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PDE2A Gene

Localization for PDE2A Gene

Subcellular locations from UniProtKB/Swiss-Prot for PDE2A Gene

Isoform PDE2A3: Cell membrane; Lipid-anchor.
Isoform PDE2A2: Mitochondrion matrix.
Isoform PDE2A1: Cytoplasm.
Isoform 5: Mitochondrion.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PDE2A gene
Compartment Confidence
plasma membrane 5
mitochondrion 5
nucleus 5
cytosol 5
endoplasmic reticulum 4
golgi apparatus 4
extracellular 1
peroxisome 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for PDE2A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IDA 10375378
GO:0005737 cytoplasm IDA,IEA 10375378
GO:0005739 mitochondrion IEA --
GO:0005741 mitochondrial outer membrane IDA 28463107
GO:0005743 mitochondrial inner membrane IDA 28463107
genes like me logo Genes that share ontologies with PDE2A: view

Pathways & Interactions for PDE2A Gene

genes like me logo Genes that share pathways with PDE2A: view

Gene Ontology (GO) - Biological Process for PDE2A Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000122 negative regulation of transcription from RNA polymerase II promoter IDA 17329248
GO:0006198 cAMP catabolic process IMP 19252089
GO:0006626 protein targeting to mitochondrion ISS --
GO:0007165 signal transduction IEA --
GO:0008152 metabolic process IDA 17329248
genes like me logo Genes that share ontologies with PDE2A: view

No data available for SIGNOR curated interactions for PDE2A Gene

Drugs & Compounds for PDE2A Gene

(33) Drugs for PDE2A Gene - From: DrugBank, ApexBio, DGIdb, FDA Approved Drugs, IUPHAR, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Tofisopam Approved Pharma Target, inhibitor 2
Dipyridamole Approved Pharma Inhibition, Inhibitor Adenosine transport inhibitor 83
Milrinone Approved Pharma Inhibition, Inhibitor, inhibitor PDE-3 inhibitor 37
Sildenafil Approved, Investigational Pharma Inhibition, Inhibitor PDE5 inhibitor, selective 0
Trapidil Approved Pharma Target, inhibitor 1

(13) Additional Compounds for PDE2A Gene - From: Novoseek and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
IBMX
Antagonist 28822-58-4

(5) Tocris Compounds for PDE2A Gene

Compound Action Cas Number
(R)-(-)-Rolipram PDE4 inhibitor. More active enantiomer of rolipram (Cat. No. 0905) 85416-75-7
IBMX PDE inhibitor (non-selective) 28822-58-4
MDL 12330A hydrochloride Adenylyl cyclase inhibitor; also cyclic nucleotide PDE inhibitor 40297-09-4
Rolipram PDE4 inhibitor 61413-54-5
Sildenafil citrate Orally active, potent PDE5 inhibitor 171599-83-0

(2) ApexBio Compounds for PDE2A Gene

Compound Action Cas Number
Bay 60-7550 Potent PDE2 inhibitor 439083-90-6
Dipyridamole 58-32-2
genes like me logo Genes that share compounds with PDE2A: view

Drug Products

Transcripts for PDE2A Gene

Unigene Clusters for PDE2A Gene

Phosphodiesterase 2A, cGMP-stimulated:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for PDE2A
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for PDE2A Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4a · 4b ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18 ^ 19a · 19b ^ 20 ^ 21 ^ 22a ·
SP1: - - - - -
SP2: - - - -
SP3: - - - - - - - - - - - - - -
SP4: -
SP5: - - -
SP6:
SP7:
SP8:
SP9:

ExUns: 22b ^ 23 ^ 24 ^ 25 ^ 26a · 26b ^ 27a · 27b ^ 28a · 28b ^ 29 ^ 30 ^ 31a · 31b
SP1: - -
SP2: -
SP3: - -
SP4: -
SP5:
SP6: -
SP7:
SP8:
SP9: -

Relevant External Links for PDE2A Gene

GeneLoc Exon Structure for
PDE2A
ECgene alternative splicing isoforms for
PDE2A

Expression for PDE2A Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PDE2A Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

mRNA differential expression in normal tissues according to GTEx for PDE2A Gene

This gene is overexpressed in Spleen (x5.1) and Brain - Cortex (x4.1).

Protein differential expression in normal tissues from HIPED for PDE2A Gene

This gene is overexpressed in Frontal cortex (24.7), Brain (20.9), and Adrenal (6.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PDE2A Gene



NURSA nuclear receptor signaling pathways regulating expression of PDE2A Gene:

PDE2A

SOURCE GeneReport for Unigene cluster for PDE2A Gene:

Hs.503163

mRNA Expression by UniProt/SwissProt for PDE2A Gene:

O00408-PDE2A_HUMAN
Tissue specificity: Expressed in brain and to a lesser extent in heart, placenta, lung, skeletal muscle, kidney and pancreas.

Evidence on tissue expression from TISSUES for PDE2A Gene

  • Nervous system(5)
  • Adrenal gland(4.4)
  • Heart(2.1)
  • Muscle(2)
  • Spleen(2)
genes like me logo Genes that share expression patterns with PDE2A: view

Primer Products

No data available for Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for PDE2A Gene

Orthologs for PDE2A Gene

This gene was present in the common ancestor of animals.

Orthologs for PDE2A Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PDE2A 33 34
  • 99.67 (n)
cow
(Bos Taurus)
Mammalia PDE2A 33 34
  • 91.59 (n)
dog
(Canis familiaris)
Mammalia PDE2A 33 34
  • 90.29 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PDE2A 34
  • 89 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Pde2a 33 16 34
  • 88.57 (n)
rat
(Rattus norvegicus)
Mammalia Pde2a 33
  • 88.17 (n)
oppossum
(Monodelphis domestica)
Mammalia PDE2A 34
  • 84 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pde2a 33
  • 72.51 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.13289 33
zebrafish
(Danio rerio)
Actinopterygii PDE2A (1 of 2) 34
  • 80 (a)
OneToMany
PDE2A (2 of 2) 34
  • 80 (a)
OneToMany
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP008304 33
  • 57.92 (n)
worm
(Caenorhabditis elegans)
Secernentea R08D7.6 35
  • 37 (a)
pde-2 34
  • 27 (a)
OneToOne
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 19 (a)
OneToOne
Species where no ortholog for PDE2A was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • lizard (Anolis carolinensis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PDE2A Gene

ENSEMBL:
Gene Tree for PDE2A (if available)
TreeFam:
Gene Tree for PDE2A (if available)

Paralogs for PDE2A Gene

Variants for PDE2A Gene

Sequence variations from dbSNP and Humsavar for PDE2A Gene

SNP ID Clin Chr 11 pos Sequence Context AA Info Type
rs1000004817 -- 72,639,031(+) ATCGA(A/C)CCCAG intron-variant
rs1000030403 -- 72,586,274(+) CAGGG(G/T)TACCC intron-variant
rs1000123112 -- 72,673,619(+) TCCCA(A/T)TTCCA intron-variant
rs1000123566 -- 72,632,188(+) TGGGC(A/G)CTGGA intron-variant
rs1000201242 -- 72,650,055(+) TTGCT(C/G)TGTCG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for PDE2A Gene

Variant ID Type Subtype PubMed ID
dgv2005n54 CNV loss 21841781
esv1004730 CNV insertion 20482838
esv1163550 CNV insertion 17803354
esv1200915 CNV insertion 17803354
esv2325810 CNV deletion 18987734
esv25409 CNV loss 19812545
esv2664373 CNV deletion 23128226
esv3302942 CNV tandem duplication 20981092
esv3304300 CNV mobile element insertion 20981092
esv3305152 CNV mobile element insertion 20981092
esv3309897 CNV mobile element insertion 20981092
esv3395175 CNV insertion 20981092
esv3401549 CNV duplication 20981092
esv3413076 CNV duplication 20981092
nsv1042182 CNV gain 25217958
nsv468633 CNV loss 19166990
nsv478394 CNV novel sequence insertion 20440878
nsv478707 CNV novel sequence insertion 20440878
nsv509429 CNV insertion 20534489
nsv523601 CNV loss 19592680
nsv825991 CNV gain 20364138
nsv832207 CNV loss 17160897

Variation tolerance for PDE2A Gene

Residual Variation Intolerance Score: 10.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 4.01; 60.25% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PDE2A Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PDE2A

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PDE2A Gene

Disorders for PDE2A Gene

MalaCards: The human disease database

(1) MalaCards diseases for PDE2A Gene - From: Novoseek and GeneCards

Disorder Aliases PubMed IDs
retinitis pigmentosa
  • retinitis pigmentosa 1
- elite association - COSMIC cancer census association via MalaCards
Search PDE2A in MalaCards View complete list of genes associated with diseases

Relevant External Links for PDE2A

Genetic Association Database (GAD)
PDE2A
Human Genome Epidemiology (HuGE) Navigator
PDE2A
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PDE2A
genes like me logo Genes that share disorders with PDE2A: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PDE2A Gene

Publications for PDE2A Gene

  1. Isolation and characterization of human cDNAs encoding a cGMP-stimulated 3',5'-cyclic nucleotide phosphodiesterase. (PMID: 9210593) Rosman GJ … Loughney K (Gene 1997) 2 3 4 22 60
  2. Mechanism for the allosteric regulation of phosphodiesterase 2A deduced from the X-ray structure of a near full-length construct. (PMID: 19828435) Pandit J … Menniti FS (Proceedings of the National Academy of Sciences of the United States of America 2009) 3 4 22 60
  3. Structural determinants for inhibitor specificity and selectivity in PDE2A using the wheat germ in vitro translation system. (PMID: 15938621) Iffland A … Ellenberger T (Biochemistry 2005) 3 4 22 60
  4. X-ray crystal structure of phosphodiesterase 2 in complex with a highly selective, nanomolar inhibitor reveals a binding-induced pocket important for selectivity. (PMID: 23899287) Zhu J … Huang Q (Journal of the American Chemical Society 2013) 3 4 60
  5. Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population. (PMID: 22446963) Okada Y … Yamamoto K (Nature genetics 2012) 3 45 60

Products for PDE2A Gene

Sources for PDE2A Gene

Content
Loading form....