Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PDE1B Gene

Aliases for PDE1B Gene

  • Phosphodiesterase 1B 2 3 5
  • Phosphodiesterase 1B, Calmodulin-Dependent 2 3
  • 63 KDa Cam-PDE 3 4
  • EC 3.1.4.17 4 61
  • Cam-PDE 1B 3 4
  • PDES1B 3 4
  • PDE1B1 3 4
  • Presumed 63kDa Form Of The Type 1 Cyclic Nucleotide Phosphodiesterase Family Known As PDE1B 3
  • Calcium/Calmodulin-Dependent 3,5-Cyclic Nucleotide Phosphodiesterase 1B 3
  • Calcium/Calmodulin-Stimulated Cyclic Nucleotide Phosphodiesterase 3
  • Epididymis Secretory Sperm Binding Protein Li 79p 3
  • Calmodulin-Stimulated Phosphodiesterase PDE1B1 3
  • HEL-S-79p 3
  • EC 3.1.4 61

External Ids for PDE1B Gene

Previous HGNC Symbols for PDE1B Gene

  • PDES1B

Previous GeneCards Identifiers for PDE1B Gene

  • GC12P055070
  • GC12P054660
  • GC12P053229
  • GC12P054943
  • GC12P051981

Summaries for PDE1B Gene

Entrez Gene Summary for PDE1B Gene

  • The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

GeneCards Summary for PDE1B Gene

PDE1B (Phosphodiesterase 1B) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and DAG and IP3 signaling. GO annotations related to this gene include calmodulin binding and 3,5-cyclic-AMP phosphodiesterase activity. An important paralog of this gene is PDE1C.

UniProtKB/Swiss-Prot for PDE1B Gene

  • Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a preference for cGMP as a substrate.

Tocris Summary for PDE1B Gene

  • Phosphodiesterases (PDEs) are a family of phosphohydrolyases that catalyze the hydrolysis of 3' cyclic phosphate bonds in adenosine and/or guanine 3',5' cyclic monophosphate (cAMP and/or cGMP). PDEs regulate the second messengers by controlling their degradation.

Gene Wiki entry for PDE1B Gene

No data available for PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PDE1B Gene

Genomics for PDE1B Gene

Regulatory Elements for PDE1B Gene

Enhancers for PDE1B Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH12F054559 1.1 Ensembl ENCODE 14.4 +11.9 11925 2.7 HDGF PKNOX1 ATF1 WRNIP1 GTF2E2 RFX5 POLR2A NFYB FOS E2F6 PDE1B PPP1R1A
GH12F054527 0.6 ENCODE 11.7 -22.0 -22049 0.2 SCRT1 CTCF ZNF654 ZNF585B IKZF1 MAX REST RAD21 PHC1P1 PDE1B NCKAP1L MIR3198-2 PPP1R1A ENSG00000257824
GH12F054571 0.5 ENCODE 11.2 +22.4 22362 0.2 RFX1 MYNN MAX PDE1B NCKAP1L PPP1R1A
GH12F054548 0.3 FANTOM5 16.9 -1.2 -1226 0.2 PDE1B ENSG00000257824
GH12F054572 0.4 ENCODE 11.2 +22.1 22087 0.0 CTCF PDE1B NCKAP1L PPP1R1A
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PDE1B on UCSC Golden Path with GeneCards custom track

Promoters for PDE1B Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001777498 250 401 HDGF INSM2 ZNF2 GLIS2 ZNF366 EGR2 ZNF263 SP3 REST ZEB2

Genomic Location for PDE1B Gene

Chromosome:
12
Start:
54,549,350 bp from pter
End:
54,579,239 bp from pter
Size:
29,890 bases
Orientation:
Plus strand

Genomic View for PDE1B Gene

Genes around PDE1B on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PDE1B Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PDE1B Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PDE1B Gene

Proteins for PDE1B Gene

  • Protein details for PDE1B Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q01064-PDE1B_HUMAN
    Recommended name:
    Calcium/calmodulin-dependent 3,5-cyclic nucleotide phosphodiesterase 1B
    Protein Accession:
    Q01064
    Secondary Accessions:
    • Q92825
    • Q96KP3

    Protein attributes for PDE1B Gene

    Size:
    536 amino acids
    Molecular mass:
    61380 Da
    Cofactor:
    Name=a divalent metal cation; Xref=ChEBI:CHEBI:60240;
    Quaternary structure:
    • Homodimer.

    Three dimensional structures from OCA and Proteopedia for PDE1B Gene

    Alternative splice isoforms for PDE1B Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PDE1B Gene

Selected DME Specific Peptides for PDE1B Gene

Q01064:
  • HAADVTQ
  • SVLENHH
  • VLATDMS
  • IHDYEHTG
  • SQIGFIDFIVEPT
  • LKKNLEY
  • KYKNPYHN
  • QGDKEAELGLPFSPLCDR
  • LISRFKIP
  • MKTALQQ
  • VYIDETR
  • EEFFRQGD
  • ESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGE
  • SIVHAVQAGIFVERM
  • YNDRSVLENHHISSVFR
  • LDTEDEL
  • IQENKQKWKERAASGITNQMSIDELSPCEEEAP
  • LHAADISHP
  • ATDMSCHFQQ

Post-translational modifications for PDE1B Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Abcam antibodies for PDE1B

Domains & Families for PDE1B Gene

Gene Families for PDE1B Gene

Protein Domains for PDE1B Gene

Graphical View of Domain Structure for InterPro Entry

Q01064

UniProtKB/Swiss-Prot:

PDE1B_HUMAN :
  • Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily.
Family:
  • Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily.
genes like me logo Genes that share domains with PDE1B: view

Function for PDE1B Gene

Molecular function for PDE1B Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Nucleoside 3,5-cyclic phosphate + H(2)O = nucleoside 5-phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Type I PDE are activated by the binding of calmodulin in the presence of Ca(2+).
UniProtKB/Swiss-Prot Function:
Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a preference for cGMP as a substrate.

Enzyme Numbers (IUBMB) for PDE1B Gene

Gene Ontology (GO) - Molecular Function for PDE1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004112 cyclic-nucleotide phosphodiesterase activity IEA --
GO:0004114 3,5-cyclic-nucleotide phosphodiesterase activity IEA --
GO:0004115 3,5-cyclic-AMP phosphodiesterase activity TAS --
GO:0004117 calmodulin-dependent cyclic-nucleotide phosphodiesterase activity TAS 9419816
GO:0005515 protein binding IPI 21044950
genes like me logo Genes that share ontologies with PDE1B: view
genes like me logo Genes that share phenotypes with PDE1B: view

Animal Models for PDE1B Gene

MGI Knock Outs for PDE1B:

Animal Model Products

  • Taconic Biosciences Mouse Models for PDE1B

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for PDE1B Gene

Localization for PDE1B Gene

Subcellular locations from UniProtKB/Swiss-Prot for PDE1B Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PDE1B gene
Compartment Confidence
cytosol 5
nucleus 4

Gene Ontology (GO) - Cellular Components for PDE1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
GO:0043025 neuronal cell body IEA --
genes like me logo Genes that share ontologies with PDE1B: view

Pathways & Interactions for PDE1B Gene

genes like me logo Genes that share pathways with PDE1B: view

Gene Ontology (GO) - Biological Process for PDE1B Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001505 regulation of neurotransmitter levels IEA --
GO:0001975 response to amphetamine IEA --
GO:0006198 cAMP catabolic process IDA 14687666
GO:0006915 apoptotic process TAS 8855339
GO:0007165 signal transduction IEA --
genes like me logo Genes that share ontologies with PDE1B: view

No data available for SIGNOR curated interactions for PDE1B Gene

Drugs & Compounds for PDE1B Gene

(19) Drugs for PDE1B Gene - From: DrugBank, ApexBio, DGIdb, FDA Approved Drugs, IUPHAR, HMDB, and Tocris

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Bepridil Approved, Withdrawn Pharma Pore Blocker, Target, inhibitor 0
Felodipine Approved, Investigational Pharma Potentiation, Activator, Target, inhibitor 22
Nicardipine Approved Pharma Antagonist, Target, inhibitor 30
Caffeine Approved Nutra Antagonist, Target, inhibitor, competitive A1 and A2B antagonist. CNS stimulant 380
Cilostazol Approved Pharma PDE3 inhibitor 103

(1) Additional Compounds for PDE1B Gene - From: Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
IBMX
Antagonist 28822-58-4

(5) Tocris Compounds for PDE1B Gene

Compound Action Cas Number
(R)-(-)-Rolipram PDE4 inhibitor. More active enantiomer of rolipram (Cat. No. 0905) 85416-75-7
IBMX PDE inhibitor (non-selective) 28822-58-4
MDL 12330A hydrochloride Adenylyl cyclase inhibitor; also cyclic nucleotide PDE inhibitor 40297-09-4
Rolipram PDE4 inhibitor 61413-54-5
Sildenafil citrate Orally active, potent PDE5 inhibitor 171599-83-0

(3) ApexBio Compounds for PDE1B Gene

Compound Action Cas Number
Cilostazol PDE3 inhibitor 73963-72-1
Sildenafil Citrate Treat erectile dysfunction and PAH 171599-83-0
Vinpocetine PDE inhibitor 42971-09-5
genes like me logo Genes that share compounds with PDE1B: view

Transcripts for PDE1B Gene

Unigene Clusters for PDE1B Gene

Phosphodiesterase 1B, calmodulin-dependent:
Representative Sequences:

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for PDE1B Gene

ExUns: 1 ^ 2 ^ 3a · 3b · 3c ^ 4 ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11 ^ 12a · 12b ^ 13a · 13b ^ 14 ^ 15 ^ 16 ^ 17
SP1: - - - - - -
SP2: - - - -
SP3: - - -
SP4: - - - - - -
SP5: - - - -
SP6:
SP7: - - -
SP8: - - - - - - - - -

Relevant External Links for PDE1B Gene

GeneLoc Exon Structure for
PDE1B
ECgene alternative splicing isoforms for
PDE1B

Expression for PDE1B Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PDE1B Gene

mRNA differential expression in normal tissues according to GTEx for PDE1B Gene

This gene is overexpressed in Brain - Putamen (basal ganglia) (x10.8), Brain - Caudate (basal ganglia) (x9.0), and Brain - Nucleus accumbens (basal ganglia) (x8.0).

Protein differential expression in normal tissues from HIPED for PDE1B Gene

This gene is overexpressed in Urine (46.6) and Frontal cortex (9.1).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PDE1B Gene



Protein tissue co-expression partners for PDE1B Gene

NURSA nuclear receptor signaling pathways regulating expression of PDE1B Gene:

PDE1B

SOURCE GeneReport for Unigene cluster for PDE1B Gene:

Hs.530871
genes like me logo Genes that share expression patterns with PDE1B: view

Primer Products

No data available for mRNA Expression by UniProt/SwissProt for PDE1B Gene

Orthologs for PDE1B Gene

This gene was present in the common ancestor of animals.

Orthologs for PDE1B Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PDE1B 34 35
  • 99.5 (n)
cow
(Bos Taurus)
Mammalia PDE1B 34 35
  • 91.76 (n)
mouse
(Mus musculus)
Mammalia Pde1b 34 16 35
  • 90.78 (n)
rat
(Rattus norvegicus)
Mammalia Pde1b 34
  • 90.65 (n)
dog
(Canis familiaris)
Mammalia PDE1B 34 35
  • 88.91 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PDE1B 35
  • 58 (a)
OneToOne
chicken
(Gallus gallus)
Aves PDE1B 35
  • 83 (a)
OneToOne
LOC777528 34
  • 80.76 (n)
lizard
(Anolis carolinensis)
Reptilia PDE1B 35
  • 72 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia pde1b 34
  • 74.55 (n)
fruit fly
(Drosophila melanogaster)
Insecta CG14940 36
  • 53 (a)
Pde1c 35
  • 21 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea T04D3.3 36
  • 54 (a)
pde-1 35
  • 36 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 47 (a)
OneToMany
Species where no ortholog for PDE1B was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • oppossum (Monodelphis domestica)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • zebrafish (Danio rerio)

Evolution for PDE1B Gene

ENSEMBL:
Gene Tree for PDE1B (if available)
TreeFam:
Gene Tree for PDE1B (if available)

Paralogs for PDE1B Gene

Paralogs for PDE1B Gene

(11) SIMAP similar genes for PDE1B Gene using alignment to 3 proteins:

genes like me logo Genes that share paralogs with PDE1B: view

Variants for PDE1B Gene

Sequence variations from dbSNP and Humsavar for PDE1B Gene

SNP ID Clin Chr 12 pos Sequence Context AA Info Type
rs10161382 -- 54,567,860(+) TATAT(A/T)TAttt intron-variant
rs1022232 -- 54,551,281(+) GAGAG(G/T)CGTTA intron-variant
rs10623018 -- 54,547,513(+) TGTGT(-/TG)GTGTG upstream-variant-2KB
rs10691039 -- 54,547,534(+) GTGTG(-/TG/TGTGTG)AATTA upstream-variant-2KB
rs10747698 -- 54,553,088(+) TCCCT(C/G)TTCCT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for PDE1B Gene

Variant ID Type Subtype PubMed ID
nsv832421 CNV gain 17160897

Variation tolerance for PDE1B Gene

Residual Variation Intolerance Score: 20.3% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 0.97; 20.02% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PDE1B Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PDE1B

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PDE1B Gene

Disorders for PDE1B Gene

Relevant External Links for PDE1B

Genetic Association Database (GAD)
PDE1B
Human Genome Epidemiology (HuGE) Navigator
PDE1B
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PDE1B

No disorders were found for PDE1B Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for PDE1B Gene

Publications for PDE1B Gene

  1. Identification and characterisation of a human calmodulin-stimulated phosphodiesterase PDE1B1. (PMID: 9419816) Yu J. … Gelinas R. (Cell. Signal. 1997) 2 3 4 22 64
  2. Inhibition of calmodulin-dependent phosphodiesterase induces apoptosis in human leukemic cells. (PMID: 8855339) Jiang X. … Epstein P.M. (Proc. Natl. Acad. Sci. U.S.A. 1996) 2 3 4 22 64
  3. Isolation and differential tissue distribution of two human cDNAs encoding PDE1 splice variants. (PMID: 11747989) Fidock M.D. … Lanfear J. (Cell. Signal. 2002) 3 4 22 64
  4. Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. (PMID: 20628086) Bailey S.D. … Anand S. (Diabetes Care 2010) 3 46 64
  5. Differentiation of human monocytes in vitro with granulocyte-macrophage colony-stimulating factor and macrophage colony-stimulating factor produces distinct changes in cGMP phosphodiesterase expression. (PMID: 14687666) Bender A.T. … Beavo J.A. (Cell. Signal. 2004) 3 22 64

Products for PDE1B Gene

Sources for PDE1B Gene

Content
Loading form....