Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PARN Gene

Aliases for PARN Gene

  • Poly(A)-Specific Ribonuclease 2 3 5
  • Deadenylation Nuclease 2 3 4
  • Polyadenylate-Specific Ribonuclease 3 4
  • Deadenylating Nuclease 3 4
  • EC 3.1.13.4 4 58
  • DAN 3 4
  • Poly(A)-Specific Ribonuclease (Deadenylation Nuclease) 2
  • Poly(A)-Specific Ribonuclease PARN 3
  • PFBMFT4 3
  • DKCB6 3

External Ids for PARN Gene

Previous GeneCards Identifiers for PARN Gene

  • GC16M014478
  • GC16P017836
  • GC16M014495
  • GC16M014437
  • GC16M014529

Summaries for PARN Gene

Entrez Gene Summary for PARN Gene

  • The protein encoded by this gene is a 3'-exoribonuclease, with similarity to the RNase D family of 3'-exonucleases. It prefers poly(A) as the substrate, hence, efficiently degrades poly(A) tails of mRNAs. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs. This protein is also involved in silencing of certain maternal mRNAs during oocyte maturation and early embryonic development, as well as in nonsense-mediated decay (NMD) of mRNAs that contain premature stop codons. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]

GeneCards Summary for PARN Gene

PARN (Poly(A)-Specific Ribonuclease) is a Protein Coding gene. Diseases associated with PARN include Pulmonary Fibrosis And/Or Bone Marrow Failure, Telomere-Related, 4 and Dyskeratosis Congenita, Autosomal Recessive 6. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Translational Control. GO annotations related to this gene include nucleic acid binding and RNA binding. An important paralog of this gene is PNLDC1.

UniProtKB/Swiss-Prot for PARN Gene

  • 3-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Interacts with both the 3-end poly(A) tail and the 5-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization.

Gene Wiki entry for PARN Gene

Additional gene information for PARN Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PARN Gene

Genomics for PARN Gene

Regulatory Elements for PARN Gene

Enhancers for PARN Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH16H015588 2.1 FANTOM5 Ensembl ENCODE dbSUPER 52 -958.6 -958595 5 MLX FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF548 SP3 MEF2D ZNF610 PARN ENSG00000263335 BFAR LOC100505915 RRN3 ABCC1 PKD1P6 ENSG00000262171 ENSG00000241067 ENSG00000263029
GH16H015517 1.7 FANTOM5 Ensembl ENCODE dbSUPER 51.9 -885.9 -885905 1 YBX3 HDGF ZSCAN4 FEZF1 GLI4 ZNF2 RAD21 TCF12 EGR1 EGR2 PARN C16orf45 BFAR LOC100505915 PKD1P6 RRN3 ENSG00000270734 ENSG00000241067 LOC105371095 ENSG00000263029
GH16H014095 1.2 Ensembl ENCODE 72.5 +535.8 535821 3 FOXA2 ZNF493 ZFP64 ZNF133 FEZF1 FOS ZNF202 ZC3H11A REST PPARG LOC100505915 PARN ENSG00000183458 RRN3 NPIPA3 NPIPA1 NPIPA2 ERCC4 BFAR PDXDC1
GH16H014283 1.4 Ensembl ENCODE 61.7 +347.3 347324 3 HDGF PKNOX1 MLX ARNT ZFP64 ARID4B SIN3A ZNF2 YY1 SLC30A9 PARN LOC100505915 ENSG00000183458 NPIPP1 NPIPA1 NPIPA3 NPIPA2 PKD1P6 RRN3 BFAR
GH16H014337 1.5 Ensembl ENCODE dbSUPER 55.3 +294.9 294865 0 FOXA2 MLX ZFP64 ARID4B YBX1 DMAP1 YY1 YY2 MXD4 REST PARN ENSG00000183458 NPIPA2 NPIPA3 LOC100505915 NPIPA1 ENSG00000261819 NPIPP1 ERCC4 LOC105371095
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around PARN on UCSC Golden Path with GeneCards custom track

Promoters for PARN Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000083721 -572 1801 HDGF PKNOX1 FOXA2 MLX ARNT ZFP64 ARID4B SIN3A DMAP1 ZBTB7B

Genomic Location for PARN Gene

Chromosome:
16
Start:
14,435,700 bp from pter
End:
14,632,728 bp from pter
Size:
197,029 bases
Orientation:
Minus strand

Genomic View for PARN Gene

Genes around PARN on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PARN Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PARN Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PARN Gene

Proteins for PARN Gene

  • Protein details for PARN Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O95453-PARN_HUMAN
    Recommended name:
    Poly(A)-specific ribonuclease PARN
    Protein Accession:
    O95453
    Secondary Accessions:
    • B2RCB3
    • B4DDG8
    • B4DSB0
    • B4DWR4
    • B4E1H6

    Protein attributes for PARN Gene

    Size:
    639 amino acids
    Molecular mass:
    73451 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Homodimer. Interacts with KHSRP and CELF1/CUGBP1. Found in a mRNA decay complex with RENT1, RENT2 and RENT3B. Interacts with ZC3HAV1 in an RNA-independent manner.

    Three dimensional structures from OCA and Proteopedia for PARN Gene

    Alternative splice isoforms for PARN Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PARN Gene

Selected DME Specific Peptides for PARN Gene

O95453:
  • TKSFNFYVFPKPF
  • IAVNTSKYAESYRIQTYA
  • EQEELNDAVGFSRVI
  • VTFPKEWKTSDLYQLFSAFGNIQ
  • GFDTPEERYQKLKKHSMDFLLFQFGLC
  • MDIPYLNLEGPDLQPKRD
  • PCTGFQRKLIYQTLSWKYPKGIHVETLET
  • PPKVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANY
  • LDTKLMAST
  • GIPYLNQEEE
  • NTSLAEL
  • LETEKKER
  • DDTSAFVSLSQ
  • TASEQLHEAGYDAYITGLCFISMANYLGSFLSPPK
  • EKKERYIVISKVDEEERKR

Post-translational modifications for PARN Gene

  • Phosphorylation by MAPKAPK2, preventing GADD45A mRNA degradation after genotoxic stress.
  • Ubiquitination at posLast=326326
  • Modification sites at PhosphoSitePlus

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for PARN (PARN)

Domains & Families for PARN Gene

Gene Families for PARN Gene

Human Protein Atlas (HPA):
  • Disease related genes
  • Enzymes
  • Potential drug targets
  • Predicted intracellular proteins

Graphical View of Domain Structure for InterPro Entry

O95453

UniProtKB/Swiss-Prot:

PARN_HUMAN :
  • Belongs to the CAF1 family.
Family:
  • Belongs to the CAF1 family.
genes like me logo Genes that share domains with PARN: view

Function for PARN Gene

Molecular function for PARN Gene

GENATLAS Biochemistry:
poly A specific ribonuclease,deadenylation nuclease,ubiquitously expressed,degrading poly A tail of mRNA molecules
UniProtKB/Swiss-Prot CatalyticActivity:
Exonucleolytic cleavage of poly(A) to 5-AMP.
UniProtKB/Swiss-Prot Function:
3-exoribonuclease that has a preference for poly(A) tails of mRNAs, thereby efficiently degrading poly(A) tails. Exonucleolytic degradation of the poly(A) tail is often the first step in the decay of eukaryotic mRNAs and is also used to silence certain maternal mRNAs translationally during oocyte maturation and early embryonic development. Interacts with both the 3-end poly(A) tail and the 5-end cap structure during degradation, the interaction with the cap structure being required for an efficient degradation of poly(A) tails. Involved in nonsense-mediated mRNA decay, a critical process of selective degradation of mRNAs that contain premature stop codons. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3-UTR, possibly via its interaction with KHSRP. Probably mediates the removal of poly(A) tails of AREs mRNAs, which constitutes the first step of destabilization.

Enzyme Numbers (IUBMB) for PARN Gene

Phenotypes From GWAS Catalog for PARN Gene

Gene Ontology (GO) - Molecular Function for PARN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003676 nucleic acid binding IEA --
GO:0003723 RNA binding IDA 22658674
GO:0003730 mRNA 3-UTR binding TAS 9736620
GO:0004518 nuclease activity TAS 9736620
GO:0004527 exonuclease activity IEA --
genes like me logo Genes that share ontologies with PARN: view
genes like me logo Genes that share phenotypes with PARN: view

Human Phenotype Ontology for PARN Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Model Products

  • Taconic Biosciences Mouse Models for PARN

CRISPR Products

Inhibitory RNA Products

No data available for Animal Models , Transcription Factor Targets and HOMER Transcription for PARN Gene

Localization for PARN Gene

Subcellular locations from UniProtKB/Swiss-Prot for PARN Gene

Nucleus. Cytoplasm. Nucleus, nucleolus. Note=Some nuclear fraction is nucleolar.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for PARN gene
Compartment Confidence
nucleus 5
cytosol 5

Subcellular locations from the

Human Protein Atlas (HPA)
  • Nuclear speckles (2)
  • Nucleoli (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for PARN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus TAS 9736620
GO:0005730 nucleolus IEA --
GO:0005737 cytoplasm TAS 9736620
GO:0005829 cytosol TAS --
genes like me logo Genes that share ontologies with PARN: view

Pathways & Interactions for PARN Gene

genes like me logo Genes that share pathways with PARN: view

Pathways by source for PARN Gene

2 Cell Signaling Technology pathways for PARN Gene
1 BioSystems pathway for PARN Gene

SIGNOR curated interactions for PARN Gene

Is inactivated by:

Gene Ontology (GO) - Biological Process for PARN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay IEA --
GO:0000289 nuclear-transcribed mRNA poly(A) tail shortening TAS --
GO:0006402 mRNA catabolic process IEA --
GO:0007292 female gamete generation TAS 9736620
GO:0009451 RNA modification TAS 9736620
genes like me logo Genes that share ontologies with PARN: view

Drugs & Compounds for PARN Gene

(1) Additional Compounds for PARN Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with PARN: view

Transcripts for PARN Gene

Unigene Clusters for PARN Gene

Poly(A)-specific ribonuclease:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for PARN Gene

No ASD Table

Relevant External Links for PARN Gene

GeneLoc Exon Structure for
PARN
ECgene alternative splicing isoforms for
PARN

Expression for PARN Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for PARN Gene

Protein differential expression in normal tissues from HIPED for PARN Gene

This gene is overexpressed in Lavage (32.3).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PARN Gene



Protein tissue co-expression partners for PARN Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of PARN Gene:

PARN

SOURCE GeneReport for Unigene cluster for PARN Gene:

Hs.253197

mRNA Expression by UniProt/SwissProt for PARN Gene:

O95453-PARN_HUMAN
Tissue specificity: Ubiquitous.

Evidence on tissue expression from TISSUES for PARN Gene

  • Nervous system(4.6)
  • Liver(4.3)
  • Adrenal gland(4.2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for PARN Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • cardiovascular
  • digestive
  • immune
  • integumentary
  • lymphatic
  • nervous
  • reproductive
  • respiratory
  • skeletal muscle
  • skeleton
  • urinary
Organs:
Head and neck:
  • brain
  • cerebellum
  • cranial nerve
  • ear
  • eye
  • eyelid
  • face
  • head
  • jaw
  • lacrimal apparatus
  • mandible
  • maxilla
  • mouth
  • neck
  • pharynx
  • salivary gland
  • scalp
  • skull
  • tooth
Thorax:
  • breast
  • bronchus
  • chest wall
  • clavicle
  • esophagus
  • heart
  • heart valve
  • lung
  • rib
  • rib cage
  • scapula
  • sternum
  • trachea
Abdomen:
  • intestine
  • kidney
  • large intestine
  • liver
  • small intestine
  • spleen
  • stomach
Pelvis:
  • anus
  • ovary
  • pelvis
  • penis
  • rectum
  • testicle
  • urethra
  • urinary bladder
  • uterus
  • vagina
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • nail
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • blood
  • blood vessel
  • bone marrow
  • coagulation system
  • hair
  • peripheral nervous system
  • red blood cell
  • skin
  • spinal column
  • sweat gland
  • vertebrae
  • white blood cell
genes like me logo Genes that share expression patterns with PARN: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for PARN Gene

Orthologs for PARN Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PARN Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PARN 33 34
  • 99.79 (n)
oppossum
(Monodelphis domestica)
Mammalia PARN 34
  • 94 (a)
OneToOne
dog
(Canis familiaris)
Mammalia PARN 33 34
  • 91.85 (n)
cow
(Bos Taurus)
Mammalia PARN 33 34
  • 91.64 (n)
mouse
(Mus musculus)
Mammalia Parn 33 16 34
  • 86.54 (n)
rat
(Rattus norvegicus)
Mammalia Parn 33
  • 85.74 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia PARN 34
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves PARN 33 34
  • 79.18 (n)
lizard
(Anolis carolinensis)
Reptilia PARN 34
  • 80 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia parn 33
  • 74.21 (n)
Str.15241 33
African clawed frog
(Xenopus laevis)
Amphibia parn-A 33
zebrafish
(Danio rerio)
Actinopterygii parn 33 34
  • 64.28 (n)
zgc56067 33
African malaria mosquito
(Anopheles gambiae)
Insecta PARN 33
  • 46.78 (n)
worm
(Caenorhabditis elegans)
Secernentea K10C8.1 33
  • 43.05 (n)
parn-1 34
  • 19 (a)
OneToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons AHG2 33
  • 43.63 (n)
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes SPBC29A10.09c 33
  • 42.7 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 31 (a)
OneToOne
Species where no ortholog for PARN was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PARN Gene

ENSEMBL:
Gene Tree for PARN (if available)
TreeFam:
Gene Tree for PARN (if available)

Paralogs for PARN Gene

Paralogs for PARN Gene

(1) SIMAP similar genes for PARN Gene using alignment to 6 proteins:

genes like me logo Genes that share paralogs with PARN: view

Variants for PARN Gene

Sequence variations from dbSNP and Humsavar for PARN Gene

SNP ID Clin Chr 16 pos Sequence Context AA Info Type
rs777090017 Pathogenic, Pulmonary fibrosis, and/or bone marrow failure, telomere-related, 4 (PFBMFT4) [MIM:616371] 14,580,874(+) CTTAC(C/T)TGTTA nc-transcript-variant, reference, missense
rs786200999 Pathogenic, Dyskeratosis congenita, autosomal recessive, 6 (DKCB6) [MIM:616353] 14,582,225(-) CGATG(C/T)CTACA nc-transcript-variant, reference, missense
rs751381953 Pathogenic 14,627,189(+) ATACC(C/T)GGGAT intron-variant, upstream-variant-2KB, splice-acceptor-variant
rs754368658 Pathogenic 14,584,383(+) TAACC(A/G)CTTTT nc-transcript-variant, reference, missense
rs756132866 Pathogenic 14,593,300(+) ACTTA(A/C)CGCAG intron-variant, splice-donor-variant

Structural Variations from Database of Genomic Variants (DGV) for PARN Gene

Variant ID Type Subtype PubMed ID
dgv2738n100 CNV gain 25217958
esv2662886 CNV deletion 23128226
esv2669004 CNV deletion 23128226
esv2714011 CNV deletion 23290073
esv2758632 CNV gain+loss 17122850
esv3397104 CNV insertion 20981092
esv3638008 CNV loss 21293372
esv3638009 CNV loss 21293372
esv3638010 CNV loss 21293372
nsv833144 CNV gain 17160897
nsv974759 CNV duplication 23825009

Variation tolerance for PARN Gene

Residual Variation Intolerance Score: 48.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.75; 33.19% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PARN Gene

Human Gene Mutation Database (HGMD)
PARN
SNPedia medical, phenotypic, and genealogical associations of SNPs for
PARN

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PARN Gene

Disorders for PARN Gene

MalaCards: The human disease database

(8) MalaCards diseases for PARN Gene - From: HGMD, OMIM, ClinVar, GeneTests, Orphanet, Swiss-Prot, DISEASES, and GeneCards

Disorder Aliases PubMed IDs
pulmonary fibrosis and/or bone marrow failure, telomere-related, 4
  • pulmonary fibrosis and/or bone marrow failure, telomere-related 4
dyskeratosis congenita, autosomal recessive 6
  • dyskeratosis congenita, autosomal recessive, 6
parn-related dyskeratosis congenita
  • dyskeratosis congenita, autosomal recessive 6
dyskeratosis congenita
  • zinsser-cole-engman syndrome
pulmonary fibrosis
  • fibrosis of lung
- elite association - COSMIC cancer census association via MalaCards
Search PARN in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

PARN_HUMAN
  • Dyskeratosis congenita, autosomal recessive, 6 (DKCB6) [MIM:616353]: A form of dyskeratosis congenita, a rare multisystem disorder caused by defective telomere maintenance. It is characterized by progressive bone marrow failure, and the clinical triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. Common but variable features include premature graying, aplastic anemia, low platelets, osteoporosis, pulmonary fibrosis, and liver fibrosis among others. Early mortality is often associated with bone marrow failure, infections, fatal pulmonary complications, or malignancy. {ECO:0000269 PubMed:25893599}. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Pulmonary fibrosis, and/or bone marrow failure, telomere-related, 4 (PFBMFT4) [MIM:616371]: A disease associated with shortened telomeres. Pulmonary fibrosis is the most common manifestation. Other manifestations include aplastic anemia due to bone marrow failure, hepatic fibrosis, and increased cancer risk, particularly myelodysplastic syndrome and acute myeloid leukemia. Phenotype, age at onset, and severity are determined by telomere length. {ECO:0000269 PubMed:25848748}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Relevant External Links for PARN

Genetic Association Database (GAD)
PARN
Human Genome Epidemiology (HuGE) Navigator
PARN
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PARN
genes like me logo Genes that share disorders with PARN: view

No data available for Genatlas for PARN Gene

Publications for PARN Gene

  1. The human gene for the poly(A)-specific ribonuclease (PARN) maps to 16p13 and has a truncated copy in the Prader-Willi/Angelman syndrome region on 15q11-->q13. (PMID: 10640832) Buiting K … Horsthemke B (Cytogenetics and cell genetics 1999) 2 3 4 22 60
  2. CUG-BP binds to RNA substrates and recruits PARN deadenylase. (PMID: 16601207) Moraes KC … Wilusz J (RNA (New York, N.Y.) 2006) 3 4 22 60
  3. Structural insight into poly(A) binding and catalytic mechanism of human PARN. (PMID: 16281054) Wu M … Song H (The EMBO journal 2005) 3 4 22 60
  4. Coordination of divalent metal ions in the active site of poly(A)-specific ribonuclease. (PMID: 15358788) Ren YG … Virtanen A (The Journal of biological chemistry 2004) 3 4 22 60
  5. A KH domain RNA binding protein, KSRP, promotes ARE-directed mRNA turnover by recruiting the degradation machinery. (PMID: 15175153) Gherzi R … Chen CY (Molecular cell 2004) 3 4 22 60

Products for PARN Gene

Sources for PARN Gene

Content
Loading form....