Free for academic non-profit institutions. Other users need a Commercial license

Aliases for PAPOLG Gene

Aliases for PAPOLG Gene

  • Poly(A) Polymerase Gamma 2 3 5
  • Signal Recognition Particle RNA-Adenylating Enzyme 3 4
  • Polynucleotide Adenylyltransferase Gamma 3 4
  • SRP RNA 3-Adenylating Enzyme 3 4
  • SRP RNA-Adenylating Enzyme 3 4
  • Neo-Poly(A) Polymerase 3 4
  • EC 2.7.7.19 4 61
  • PAP-Gamma 3 4
  • Neo-PAP 3 4
  • SRP RNA 3 Adenylating Enzyme/Pap2 3
  • Nuclear Poly(A) Polymerase Gamma 3
  • PAP2 4
  • PAPG 4

External Ids for PAPOLG Gene

Previous GeneCards Identifiers for PAPOLG Gene

  • GC02P061111
  • GC02P060941
  • GC02P060957
  • GC02P060895
  • GC02P060836
  • GC02P060983
  • GC02P060725

Summaries for PAPOLG Gene

Entrez Gene Summary for PAPOLG Gene

  • This gene encodes a member of the poly(A) polymerase family which catalyzes template-independent extension of the 3' end of a DNA/RNA strand. This enzyme shares 60% identity to the well characterized poly(A) polymerase II (PAPII) at the amino acid level. These two enzymes have similar organization of structural and functional domains. This enzyme is exclusively localized in the nucleus and exhibits both nonspecific and CPSF (cleavage and polyadenylation specificity factor)/AAUAAA-dependent polyadenylation activity. This gene is located on chromosome 2 in contrast to the PAPII gene, which is located on chromosome 14. [provided by RefSeq, Jul 2008]

GeneCards Summary for PAPOLG Gene

PAPOLG (Poly(A) Polymerase Gamma) is a Protein Coding gene. Diseases associated with PAPOLG include Acute Cystitis and Bladder Disease. Among its related pathways are mRNA surveillance pathway. GO annotations related to this gene include RNA binding and polynucleotide adenylyltransferase activity. An important paralog of this gene is PAPOLA.

UniProtKB/Swiss-Prot for PAPOLG Gene

  • Responsible for the post-transcriptional adenylation of the 3-terminal of mRNA precursors and several small RNAs including signal recognition particle (SRP) RNA, nuclear 7SK RNA, U2 small nuclear RNA, and ribosomal 5S RNA.

Gene Wiki entry for PAPOLG Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for PAPOLG Gene

Genomics for PAPOLG Gene

Regulatory Elements for PAPOLG Gene

Enhancers for PAPOLG Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH02F061015 0.7 ENCODE 29.6 +261.7 261669 4.4 CREB3L1 MLX FEZF1 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 SP3 NFYC PAPOLG PEX13 PUS10 ENSG00000236498 FAM161A ENSG00000232713 AHSA2
GH02F061658 1.1 Ensembl ENCODE 20.4 +903.8 903806 2.6 PKNOX1 CREB3L1 ARID4B SIN3A DMAP1 ZNF2 YY1 ZNF766 ZNF143 ZNF207 PAPOLG RNU6-1145P ENSG00000236498 ENSG00000232713 LOC105377633 AHSA2 GC02M061677 GC02P061626
GH02F061534 1.1 FANTOM5 ENCODE 19.2 +781.2 781161 5.2 MLX CREB3L1 DMAP1 YY1 SLC30A9 ZNF143 ZNF263 SP3 NFYC TBX21 LOC339803 PAPOLG PEX13 AHSA2 ENSG00000236498 ENSG00000232713 REL LOC105377633 ENSG00000273302 KIAA1841
GH02F060837 1.1 FANTOM5 ENCODE 15.9 +83.6 83611 4.3 HDGF PKNOX1 ATF1 ARID4B SIN3A DMAP1 ZNF48 ZNF121 GLIS2 KLF13 PAPOLG REL LINC01185 KIAA1841 AHSA2 PUS10 ENSG00000232713 C2orf74 PEX13 RN7SL632P
GH02F061693 0.8 Ensembl ENCODE 12.1 +938.4 938350 2.0 HDGF PKNOX1 SIN3A DMAP1 ZNF48 GLIS2 ZNF143 ZNF207 KDM4B SP3 PAPOLG AHSA2 GC02M061677 LOC647077
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around PAPOLG on UCSC Golden Path with GeneCards custom track

Promoters for PAPOLG Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000013404 571 2400 HDGF MLX SIN3A FEZF1 DMAP1 YY1 GLIS2 ZNF143 ZNF207 KLF13

Genomic Location for PAPOLG Gene

Chromosome:
2
Start:
60,756,230 bp from pter
End:
60,802,086 bp from pter
Size:
45,857 bases
Orientation:
Plus strand

Genomic View for PAPOLG Gene

Genes around PAPOLG on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
PAPOLG Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for PAPOLG Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for PAPOLG Gene

Proteins for PAPOLG Gene

  • Protein details for PAPOLG Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9BWT3-PAPOG_HUMAN
    Recommended name:
    Poly(A) polymerase gamma
    Protein Accession:
    Q9BWT3
    Secondary Accessions:
    • B2RBH4
    • Q59G05
    • Q969N1
    • Q9H8L2
    • Q9HAD0

    Protein attributes for PAPOLG Gene

    Size:
    736 amino acids
    Molecular mass:
    82803 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=BAB14604.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for PAPOLG Gene

    Alternative splice isoforms for PAPOLG Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for PAPOLG Gene

Selected DME Specific Peptides for PAPOLG Gene

Q9BWT3:
  • KFFLVFS
  • SLNGCRVTD
  • PNFFQKY
  • SESKNLP
  • NLNLPVWDPRVNPSDRYHLMPIITPAYPQQNSTYNV
  • WEWPNPVLLK
  • CQLYPNA
  • WAMLVAR
  • DLTYDIQSFTDTVYRQA
  • LEWVGLVESKIR

Post-translational modifications for PAPOLG Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Antibody Products

  • Abcam antibodies for PAPOLG

Domains & Families for PAPOLG Gene

Suggested Antigen Peptide Sequences for PAPOLG Gene

Graphical View of Domain Structure for InterPro Entry

Q9BWT3

UniProtKB/Swiss-Prot:

PAPOG_HUMAN :
  • Belongs to the poly(A) polymerase family.
Family:
  • Belongs to the poly(A) polymerase family.
genes like me logo Genes that share domains with PAPOLG: view

No data available for Gene Families for PAPOLG Gene

Function for PAPOLG Gene

Molecular function for PAPOLG Gene

UniProtKB/Swiss-Prot BiophysicochemicalProperties:
Kinetic parameters: KM=0.051 uM for poly(A)(15) {ECO:0000269 PubMed:11431479};
UniProtKB/Swiss-Prot CatalyticActivity:
ATP + RNA(n) = diphosphate + RNA(n+1).
UniProtKB/Swiss-Prot Function:
Responsible for the post-transcriptional adenylation of the 3-terminal of mRNA precursors and several small RNAs including signal recognition particle (SRP) RNA, nuclear 7SK RNA, U2 small nuclear RNA, and ribosomal 5S RNA.

Enzyme Numbers (IUBMB) for PAPOLG Gene

Gene Ontology (GO) - Molecular Function for PAPOLG Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0003723 RNA binding IEA --
GO:0004652 polynucleotide adenylyltransferase activity IEA,IDA 11463842
GO:0005524 ATP binding IEA --
GO:0016740 transferase activity IEA --
GO:0016779 nucleotidyltransferase activity IEA --
genes like me logo Genes that share ontologies with PAPOLG: view
genes like me logo Genes that share phenotypes with PAPOLG: view

Animal Model Products

  • Taconic Biosciences Mouse Models for PAPOLG

miRNA for PAPOLG Gene

miRTarBase miRNAs that target PAPOLG

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for PAPOLG Gene

Localization for PAPOLG Gene

Subcellular locations from UniProtKB/Swiss-Prot for PAPOLG Gene

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for PAPOLG Gene COMPARTMENTS Subcellular localization image for PAPOLG gene
Compartment Confidence
nucleus 5
cytosol 3

Gene Ontology (GO) - Cellular Components for PAPOLG Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 11463842
GO:0005654 nucleoplasm IDA --
GO:0005737 cytoplasm IDA --
GO:0016020 membrane IDA 19946888
genes like me logo Genes that share ontologies with PAPOLG: view

Pathways & Interactions for PAPOLG Gene

SuperPathways for PAPOLG Gene

SuperPathway Contained pathways
1 mRNA surveillance pathway
genes like me logo Genes that share pathways with PAPOLG: view

Pathways by source for PAPOLG Gene

1 KEGG pathway for PAPOLG Gene

Gene Ontology (GO) - Biological Process for PAPOLG Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006378 mRNA polyadenylation IBA --
GO:0006397 mRNA processing IEA --
GO:0031123 RNA 3-end processing IEA --
GO:0043631 RNA polyadenylation IEA,IDA 11287430
genes like me logo Genes that share ontologies with PAPOLG: view

No data available for SIGNOR curated interactions for PAPOLG Gene

Drugs & Compounds for PAPOLG Gene

(2) Drugs for PAPOLG Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine triphosphate Approved Nutra 0

(1) Additional Compounds for PAPOLG Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
genes like me logo Genes that share compounds with PAPOLG: view

Transcripts for PAPOLG Gene

Unigene Clusters for PAPOLG Gene

Poly(A) polymerase gamma:
Representative Sequences:

Inhibitory RNA Products

Clone Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for PAPOLG Gene

ExUns: 1a · 1b · 1c ^ 2 ^ 3a · 3b ^ 4 ^ 5a · 5b ^ 6 ^ 7 ^ 8 ^ 9 ^ 10a · 10b ^ 11a · 11b ^ 12 ^ 13 ^ 14a · 14b ^ 15 ^ 16 ^ 17a · 17b ^ 18a ·
SP1: - -
SP2:
SP3: - -
SP4: -
SP5:
SP6: - -
SP7:
SP8:

ExUns: 18b ^ 19 ^ 20a · 20b
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:

Relevant External Links for PAPOLG Gene

GeneLoc Exon Structure for
PAPOLG
ECgene alternative splicing isoforms for
PAPOLG

Expression for PAPOLG Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for PAPOLG Gene

Protein differential expression in normal tissues from HIPED for PAPOLG Gene

This gene is overexpressed in Pancreatic juice (40.1), Adipocyte (10.8), and Testis (8.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for PAPOLG Gene



Protein tissue co-expression partners for PAPOLG Gene

NURSA nuclear receptor signaling pathways regulating expression of PAPOLG Gene:

PAPOLG

SOURCE GeneReport for Unigene cluster for PAPOLG Gene:

Hs.387471

mRNA Expression by UniProt/SwissProt for PAPOLG Gene:

Q9BWT3-PAPOG_HUMAN
Tissue specificity: Expressed predominantly in testis, and weakly in other tissues. Overexpressed in several tumors.
genes like me logo Genes that share expression patterns with PAPOLG: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA differential expression in normal tissues for PAPOLG Gene

Orthologs for PAPOLG Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for PAPOLG Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia PAPOLG 34 35
  • 99.77 (n)
dog
(Canis familiaris)
Mammalia PAPOLG 34 35
  • 93.86 (n)
cow
(Bos Taurus)
Mammalia PAPOLG 34 35
  • 93.2 (n)
mouse
(Mus musculus)
Mammalia Papolg 34 16 35
  • 91.64 (n)
rat
(Rattus norvegicus)
Mammalia Papolg 34
  • 89.96 (n)
oppossum
(Monodelphis domestica)
Mammalia PAPOLG 35
  • 86 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia PAPOLG 35
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves PAPOLG 34 35
  • 73.48 (n)
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 63 (a)
OneToMany
-- 35
  • 56 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia papolg 34
  • 72.47 (n)
zebrafish
(Danio rerio)
Actinopterygii papolg 34 35
  • 70.17 (n)
zgc63762 34
rainbow trout
(Oncorhynchus mykiss)
Actinopterygii Omy.6689 34
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP013207 34
  • 59.37 (n)
fruit fly
(Drosophila melanogaster)
Insecta hrg 36 34 35
  • 58.07 (n)
worm
(Caenorhabditis elegans)
Secernentea T15H9.6 36 35
  • 45 (a)
Y32F6A.3 36
  • 43 (a)
F43G6.5 35
  • 43 (a)
ManyToMany
pap-1 35
  • 38 (a)
ManyToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PAP1 34 35 37
  • 54.64 (n)
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0B13255g 34
  • 54.22 (n)
A. gosspyii yeast
(Ashbya gossypii)
Saccharomycetes AGOS_ABL002C 34
  • 49.29 (n)
thale cress
(Arabidopsis thaliana)
eudicotyledons PAPS1 34
  • 50.57 (n)
rice
(Oryza sativa)
Liliopsida Os06g0319600 34
  • 52.94 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.2725 35
  • 64 (a)
OneToMany
fission yeast
(Schizosaccharomyces pombe)
Schizosaccharomycetes pla1 34
  • 53.69 (n)
bread mold
(Neurospora crassa)
Ascomycetes NCU08983 34
  • 48.07 (n)
Species where no ortholog for PAPOLG was found in the sources mined by GeneCards:
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for PAPOLG Gene

ENSEMBL:
Gene Tree for PAPOLG (if available)
TreeFam:
Gene Tree for PAPOLG (if available)

Paralogs for PAPOLG Gene

Paralogs for PAPOLG Gene

(3) SIMAP similar genes for PAPOLG Gene using alignment to 8 proteins:

genes like me logo Genes that share paralogs with PAPOLG: view

Variants for PAPOLG Gene

Sequence variations from dbSNP and Humsavar for PAPOLG Gene

SNP ID Clin Chr 02 pos Sequence Context AA Info Type
rs10084353 -- 60,793,418(+) aatta(A/G)cccga intron-variant
rs10171532 -- 60,790,335(+) CAGAT(G/T)AAGAA intron-variant
rs10172614 -- 60,764,504(+) CTCCG(C/T)CTCCC intron-variant
rs10183870 -- 60,778,272(+) ctccc(C/G)agtag intron-variant
rs10186916 -- 60,786,418(+) TAAAG(A/G)CAGGG intron-variant

Structural Variations from Database of Genomic Variants (DGV) for PAPOLG Gene

Variant ID Type Subtype PubMed ID
dgv3859n100 CNV gain 25217958
dgv6908n54 CNV gain 21841781
esv3591007 CNV gain 21293372
esv3591008 CNV loss 21293372
nsv834215 CNV loss 17160897

Variation tolerance for PAPOLG Gene

Residual Variation Intolerance Score: 3.85% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 1.03; 21.17% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for PAPOLG Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
PAPOLG

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for PAPOLG Gene

Disorders for PAPOLG Gene

MalaCards: The human disease database

(3) MalaCards diseases for PAPOLG Gene - From: DISEASES

Disorder Aliases PubMed IDs
acute cystitis
  • urinary tract infection
bladder disease
  • urinary bladder disease
chromosome 2p16.1-p15 deletion syndrome
  • 2p15-p16.1 microdeletion syndrome
- elite association - COSMIC cancer census association via MalaCards

Relevant External Links for PAPOLG

Genetic Association Database (GAD)
PAPOLG
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
PAPOLG
genes like me logo Genes that share disorders with PAPOLG: view

No data available for UniProtKB/Swiss-Prot and Genatlas for PAPOLG Gene

Publications for PAPOLG Gene

  1. A novel nuclear human poly(A) polymerase (PAP), PAP gamma. (PMID: 11431479) Kyriakopoulou C.B. … Virtanen A. (J. Biol. Chem. 2001) 3 4 22 64
  2. Crystal structure of human poly(a) polymerase gamma reveals a conserved catalytic core for canonical poly(a) polymerases. (PMID: 24076191) Yang Q. … DoubliAc S. (J. Mol. Biol. 2014) 3 4 64
  3. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T. … Sugano S. (Nat. Genet. 2004) 3 4 64
  4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PMID: 15489334) Gerhard D.S. … Malek J. (Genome Res. 2004) 3 4 64
  5. Purification, characterization, and cloning of the cDNA of human signal recognition particle RNA 3'-adenylating enzyme. (PMID: 11287430) Perumal K. … Reddy R. (J. Biol. Chem. 2001) 3 4 64

Products for PAPOLG Gene

Sources for PAPOLG Gene

Content
Loading form....