Free for academic non-profit institutions. Other users need a Commercial license

Aliases for OXSR1 Gene

Aliases for OXSR1 Gene

  • Oxidative Stress Responsive 1 2 3 5
  • Oxidative Stress-Responsive 1 Protein 3 4
  • EC 2.7.11.1 4 61
  • Osr1 3 4
  • Serine/Threonine-Protein Kinase OSR1 3
  • Oxidative-Stress Responsive 1 2
  • EC 2.7.11 61
  • KIAA1101 4

External Ids for OXSR1 Gene

Previous HGNC Symbols for OXSR1 Gene

  • OSR1

Summaries for OXSR1 Gene

Entrez Gene Summary for OXSR1 Gene

  • The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton. [provided by RefSeq, Jul 2008]

GeneCards Summary for OXSR1 Gene

OXSR1 (Oxidative Stress Responsive 1) is a Protein Coding gene. Among its related pathways are Diuretics Pathway, Pharmacodynamics and Cytoskeletal Signaling. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is STK39.

UniProtKB/Swiss-Prot for OXSR1 Gene

  • Regulates downstream kinases in response to environmental stress. May also have a function in regulating the actin cytoskeleton.

Gene Wiki entry for OXSR1 Gene

No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for OXSR1 Gene

Genomics for OXSR1 Gene

Regulatory Elements for OXSR1 Gene

Enhancers for OXSR1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH03F038163 0.9 FANTOM5 ENCODE 31 +2.3 2276 7.7 HDGF PKNOX1 ARNT CREB3L1 MLX WRNIP1 ZFP64 SIN3A FEZF1 DMAP1 OXSR1 ACAA1 MYD88 C3orf35 ITGA9-AS1 GORASP1 SLC22A13 ACVR2B-AS1 NDUFAF4P3 VILL
GH03F038001 1.1 FANTOM5 Ensembl ENCODE 19.8 -158.5 -158526 9.9 HDGF ATF1 PKNOX1 MLX WRNIP1 ZNF133 ARID4B SIN3A ZNF48 ZNF2 OXSR1 VILL SLC22A14 GC03P038014
GH03F037242 0.4 ENCODE 19.7 -921.4 -921372 3.3 HDGF PKNOX1 CREB3L1 MLX WRNIP1 ARID4B SIN3A FEZF1 DMAP1 ZNF2 LRRFIP2 OXSR1 ITGA9-AS1 GOLGA4 RPS16P4 ENSG00000272334 NDUFAF4P3 ENSG00000270194
GH03F037227 0.2 ENCODE 19.7 -935.7 -935713 2.8 ATF1 ARNT MLX ARID4B DMAP1 ZNF48 YY1 SLC30A9 ELK1 GATA2 LRRFIP2 OXSR1 GOLGA4 RPS16P4 TCEA1P2 RPL29P11 NDUFAF4P3 MLH1 ENSG00000271653
GH03F038147 1.2 FANTOM5 Ensembl ENCODE 12.8 -13.6 -13559 8.2 ATF1 ZFP64 ZNF121 GATA2 FOS NFYC REST MEF2D MAFF SMARCA4 VILL MYD88 OXSR1 TCEA1P2 ACAA1 SLC22A13 NDUFAF4P3 ACVR2B-AS1 PLCD1
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around OXSR1 on UCSC Golden Path with GeneCards custom track

Promoters for OXSR1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001361368 611 2601 HDGF PKNOX1 ARNT CREB3L1 MLX WRNIP1 ZFP64 SIN3A FEZF1 DMAP1

Genomic Location for OXSR1 Gene

Chromosome:
3
Start:
38,165,089 bp from pter
End:
38,255,488 bp from pter
Size:
90,400 bases
Orientation:
Plus strand

Genomic View for OXSR1 Gene

Genes around OXSR1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
OXSR1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for OXSR1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for OXSR1 Gene

Proteins for OXSR1 Gene

  • Protein details for OXSR1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O95747-OXSR1_HUMAN
    Recommended name:
    Serine/threonine-protein kinase OSR1
    Protein Accession:
    O95747
    Secondary Accessions:
    • Q3LR53
    • Q7Z501
    • Q9UPQ1

    Protein attributes for OXSR1 Gene

    Size:
    527 amino acids
    Molecular mass:
    58022 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Binds to and phosphorylates PAK1. Interacts with chloride channel proteins SLC12A6 isoform 2, SLC12A1 and SLC12A2 but not with SLC12A4 and SLC12A7, possibly establishing sensor/signaling modules that initiate the cellular response to environmental stress. Binds to and phosphorylates RELL1, RELL2 AND RELT.
    SequenceCaution:
    • Sequence=AAP97192.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA83053.2; Type=Frameshift; Positions=63; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for OXSR1 Gene

neXtProt entry for OXSR1 Gene

Selected DME Specific Peptides for OXSR1 Gene

O95747:
  • RGYDFKA
  • RPTAAELL
  • KAGNILL
  • KELNDIRFEFTPGRDTA
  • KFFQKAKN
  • GITAIEL
  • KLIGFAQLS
  • VAIKRINLEKCQTSMDELLKEIQAMSQC
  • SSALPWS
  • ILLGEDG
  • YELQEVIGSGATAVVQAA
  • KKYGKSFRK
  • VIVAANLQKIV
  • SLCLQKDP
  • AAISQLRSPRVK
  • YYTSFVVKDELWLVMKLLSGGS
  • KKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEG

Post-translational modifications for OXSR1 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for OXSR1 Gene

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for OXSR1 (OSR1)
  • Abcam antibodies for OXSR1

Domains & Families for OXSR1 Gene

Gene Families for OXSR1 Gene

Suggested Antigen Peptide Sequences for OXSR1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O95747

UniProtKB/Swiss-Prot:

OXSR1_HUMAN :
  • Contains 1 protein kinase domain.
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Domain:
  • Contains 1 protein kinase domain.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
genes like me logo Genes that share domains with OXSR1: view

Function for OXSR1 Gene

Molecular function for OXSR1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
By autophosphorylation on threonine.
UniProtKB/Swiss-Prot Function:
Regulates downstream kinases in response to environmental stress. May also have a function in regulating the actin cytoskeleton.

Enzyme Numbers (IUBMB) for OXSR1 Gene

Gene Ontology (GO) - Molecular Function for OXSR1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding IDA 14707132
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA,IDA 14707132
GO:0004702 signal transducer, downstream of receptor, with serine/threonine kinase activity IEA,IBA --
GO:0005515 protein binding IPI 17721439
genes like me logo Genes that share ontologies with OXSR1: view
genes like me logo Genes that share phenotypes with OXSR1: view

Animal Models for OXSR1 Gene

MGI Knock Outs for OXSR1:

Animal Model Products

  • Taconic Biosciences Mouse Models for OXSR1

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for OXSR1

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for OXSR1 Gene

Localization for OXSR1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for OXSR1 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Jensen Localization Image for OXSR1 Gene COMPARTMENTS Subcellular localization image for OXSR1 gene
Compartment Confidence
extracellular 5
cytosol 4
nucleus 2

Gene Ontology (GO) - Cellular Components for OXSR1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IEA --
GO:0005737 cytoplasm IDA --
GO:0070062 extracellular exosome IDA 19056867
genes like me logo Genes that share ontologies with OXSR1: view

Pathways & Interactions for OXSR1 Gene

genes like me logo Genes that share pathways with OXSR1: view

Pathways by source for OXSR1 Gene

1 Cell Signaling Technology pathway for OXSR1 Gene
1 PharmGKB pathway for OXSR1 Gene

SIGNOR curated interactions for OXSR1 Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for OXSR1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA,IDA 14707132
GO:0006979 response to oxidative stress IEA --
GO:0016310 phosphorylation IEA --
GO:0018107 peptidyl-threonine phosphorylation IEA,IDA 24393035
GO:0023014 signal transduction by protein phosphorylation IEA --
genes like me logo Genes that share ontologies with OXSR1: view

Drugs & Compounds for OXSR1 Gene

(6) Drugs for OXSR1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Adenosine triphosphate Approved Nutra 0
Magnesium Nutra 0

(4) Additional Compounds for OXSR1 Gene - From: Novoseek and HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
Chloride ion
  • Bertholite
  • Chloor
  • Chlor
  • Chlore
  • Chloride
16887-00-6
genes like me logo Genes that share compounds with OXSR1: view

Transcripts for OXSR1 Gene

Unigene Clusters for OXSR1 Gene

Oxidative-stress responsive 1:
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for OXSR1

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for OXSR1 Gene

No ASD Table

Relevant External Links for OXSR1 Gene

GeneLoc Exon Structure for
OXSR1
ECgene alternative splicing isoforms for
OXSR1

Expression for OXSR1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for OXSR1 Gene

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for OXSR1 Gene



Protein tissue co-expression partners for OXSR1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of OXSR1 Gene:

OXSR1

SOURCE GeneReport for Unigene cluster for OXSR1 Gene:

Hs.475970

mRNA Expression by UniProt/SwissProt for OXSR1 Gene:

O95747-OXSR1_HUMAN
Tissue specificity: Ubiquitously expressed in all tissue examined.
genes like me logo Genes that share expression patterns with OXSR1: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues and Protein differential expression in normal tissues for OXSR1 Gene

Orthologs for OXSR1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for OXSR1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia OXSR1 34 35
  • 99.75 (n)
dog
(Canis familiaris)
Mammalia OXSR1 34 35
  • 93.99 (n)
cow
(Bos Taurus)
Mammalia OXSR1 34 35
  • 93.04 (n)
rat
(Rattus norvegicus)
Mammalia Oxsr1 34
  • 90.58 (n)
mouse
(Mus musculus)
Mammalia Oxsr1 34 16 35
  • 90.51 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia OXSR1 35
  • 88 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia OXSR1 35
  • 73 (a)
OneToOne
chicken
(Gallus gallus)
Aves OXSR1 34 35
  • 81.4 (n)
lizard
(Anolis carolinensis)
Reptilia OXSR1 35
  • 88 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia stk39 34
  • 75.37 (n)
Str.5309 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.12346 34
zebrafish
(Danio rerio)
Actinopterygii oxsr1a 35
  • 82 (a)
OneToMany
oxsr1b 35
  • 82 (a)
OneToMany
zgc55494 34
fruit fly
(Drosophila melanogaster)
Insecta fray 34 35
  • 56.8 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006715 34
  • 54.04 (n)
worm
(Caenorhabditis elegans)
Secernentea gck-3 34 35
  • 58.97 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes SKM1 35
  • 16 (a)
ManyToMany
CLA4 35
  • 13 (a)
ManyToMany
rice
(Oryza sativa)
Liliopsida Os.18600 34
sea squirt
(Ciona savignyi)
Ascidiacea CSA.9457 35
  • 61 (a)
OneToMany
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.5075 34
Species where no ortholog for OXSR1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for OXSR1 Gene

ENSEMBL:
Gene Tree for OXSR1 (if available)
TreeFam:
Gene Tree for OXSR1 (if available)

Paralogs for OXSR1 Gene

Variants for OXSR1 Gene

Sequence variations from dbSNP and Humsavar for OXSR1 Gene

SNP ID Clin Chr 03 pos Sequence Context AA Info Type
VAR_040969 A metastatic melanoma sample
rs10222606 -- 38,184,954(+) TTTGG(G/T)TTTCT intron-variant
rs10440142 -- 38,248,742(+) ACTTA(A/G)TATAC intron-variant
rs10538882 -- 38,163,444(+) GCTTA(-/AT)ATATA intron-variant, upstream-variant-2KB
rs10539481 -- 38,227,547(+) CATCC(-/A)CACAC intron-variant

Structural Variations from Database of Genomic Variants (DGV) for OXSR1 Gene

Variant ID Type Subtype PubMed ID
esv274896 CNV loss 21479260
esv3568700 CNV loss 25503493
esv3595905 OTHER inversion 21293372
nsv3768 CNV insertion 18451855

Variation tolerance for OXSR1 Gene

Residual Variation Intolerance Score: 21.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 8.02; 84.24% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for OXSR1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
OXSR1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for OXSR1 Gene

Disorders for OXSR1 Gene

Relevant External Links for OXSR1

Human Genome Epidemiology (HuGE) Navigator
OXSR1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
OXSR1

No disorders were found for OXSR1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for OXSR1 Gene

Publications for OXSR1 Gene

  1. Isolation and characterization of a novel serine threonine kinase gene on chromosome 3p22-21.3. (PMID: 10083736) Tamari M. … Nakamura Y. (J. Hum. Genet. 1999) 2 3 4 64
  2. Activation of the thiazide-sensitive Na+-Cl- cotransporter by the WNK-regulated kinases SPAK and OSR1. (PMID: 18270262) Richardson C. … Alessi D.R. (J. Cell. Sci. 2008) 3 22 64
  3. Structural insights into the recognition of substrates and activators by the OSR1 kinase. (PMID: 17721439) Villa F. … van Aalten D.M. (EMBO Rep. 2007) 3 22 64
  4. Identification of RELT homologues that associate with RELT and are phosphorylated by OSR1. (PMID: 16389068) Cusick J.K. … Shu H.-B. (Biochem. Biophys. Res. Commun. 2006) 3 4 64
  5. Functional interactions of the SPAK/OSR1 kinases with their upstream activator WNK1 and downstream substrate NKCC1. (PMID: 16669787) Vitari A.C. … Alessi D.R. (Biochem. J. 2006) 3 22 64

Products for OXSR1 Gene

Sources for OXSR1 Gene

Content
Loading form....