Free for academic non-profit institutions. Other users need a Commercial license

Aliases for OXSR1 Gene

Aliases for OXSR1 Gene

  • Oxidative Stress Responsive 1 2 3 5
  • Oxidative Stress-Responsive 1 Protein 3 4
  • EC 2.7.11.1 4 58
  • Osr1 3 4
  • Serine/Threonine-Protein Kinase OSR1 3
  • Oxidative-Stress Responsive 1 2
  • EC 2.7.11 58
  • KIAA1101 4

External Ids for OXSR1 Gene

Previous HGNC Symbols for OXSR1 Gene

  • OSR1

Summaries for OXSR1 Gene

Entrez Gene Summary for OXSR1 Gene

  • The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton. [provided by RefSeq, Jul 2008]

GeneCards Summary for OXSR1 Gene

OXSR1 (Oxidative Stress Responsive 1) is a Protein Coding gene. Among its related pathways are Cytoskeletal Signaling and Diuretics Pathway, Pharmacodynamics. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is STK39.

UniProtKB/Swiss-Prot for OXSR1 Gene

  • Regulates downstream kinases in response to environmental stress. May also have a function in regulating the actin cytoskeleton.

Gene Wiki entry for OXSR1 Gene

Additional gene information for OXSR1 Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for OXSR1 Gene

Genomics for OXSR1 Gene

Regulatory Elements for OXSR1 Gene

Enhancers for OXSR1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH03H038163 2 FANTOM5 Ensembl ENCODE dbSUPER 31 +2.1 2110 7 HDGF PKNOX1 MLX ARNT ZFP64 SIN3A FEZF1 DMAP1 ZNF2 YY1 OXSR1 ACAA1 MYD88 C3orf35 GORASP1 SLC22A13 ACVR2B-AS1 VILL PLCD1 DLEC1
GH03H039145 2.1 FANTOM5 Ensembl ENCODE dbSUPER 21 +986.0 986008 10 HDGF PKNOX1 ARNT ARID4B SIN3A FEZF1 DMAP1 YY1 ZNF766 ZNF207 GORASP1 SNORA62 TTC21A CX3CR1 OXSR1 WDR48 CSRNP1 XIRP1 MOBP ACVR2B-AS1
GH03H038150 1.8 FANTOM5 Ensembl ENCODE dbSUPER 12.8 -12.0 -11976 5 HDAC1 GATA2 FOS ATF7 RUNX3 CEBPB NFYC USF2 ZEB2 REST VILL MYD88 OXSR1 ACAA1
GH03H039050 1.1 ENCODE 16.2 +886.9 886927 2 HNRNPUL1 HDGF PKNOX1 FOXA2 ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 OXSR1 TTC21A SNORA62 WDR48 PIR55888 GC03M039097
GH03H039124 1.4 Ensembl ENCODE dbSUPER 12.6 +961.4 961376 3 HDGF ARNT ZSCAN4 RAD21 ZNF143 FOS RUNX3 ZHX1 EGR2 SMARCA5 TTC21A CSRNP1 GORASP1 OXSR1 SNORA62 XIRP1 CX3CR1 MIR6822
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around OXSR1 on UCSC Golden Path with GeneCards custom track

Promoters for OXSR1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000150979 711 2401 HDGF PKNOX1 MLX ARNT ZFP64 SIN3A FEZF1 DMAP1 ZNF2 YY1

Genomic Location for OXSR1 Gene

Chromosome:
3
Start:
38,165,089 bp from pter
End:
38,255,488 bp from pter
Size:
90,400 bases
Orientation:
Plus strand

Genomic View for OXSR1 Gene

Genes around OXSR1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
OXSR1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for OXSR1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for OXSR1 Gene

Proteins for OXSR1 Gene

  • Protein details for OXSR1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O95747-OXSR1_HUMAN
    Recommended name:
    Serine/threonine-protein kinase OSR1
    Protein Accession:
    O95747
    Secondary Accessions:
    • Q3LR53
    • Q7Z501
    • Q9UPQ1

    Protein attributes for OXSR1 Gene

    Size:
    527 amino acids
    Molecular mass:
    58022 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    • Binds to and phosphorylates PAK1. Interacts with chloride channel proteins SLC12A6 isoform 2, SLC12A1 and SLC12A2 but not with SLC12A4 and SLC12A7, possibly establishing sensor/signaling modules that initiate the cellular response to environmental stress. Binds to and phosphorylates RELL1, RELL2 AND RELT.
    SequenceCaution:
    • Sequence=AAP97192.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA83053.2; Type=Frameshift; Positions=63; Evidence={ECO:0000305};

    Three dimensional structures from OCA and Proteopedia for OXSR1 Gene

neXtProt entry for OXSR1 Gene

Selected DME Specific Peptides for OXSR1 Gene

O95747:
  • RGYDFKA
  • RPTAAELL
  • KAGNILL
  • KELNDIRFEFTPGRDTA
  • KFFQKAKN
  • GITAIEL
  • KLIGFAQLS
  • VAIKRINLEKCQTSMDELLKEIQAMSQC
  • SSALPWS
  • ILLGEDG
  • YELQEVIGSGATAVVQAA
  • KKYGKSFRK
  • VIVAANLQKIV
  • SLCLQKDP
  • AAISQLRSPRVK
  • YYTSFVVKDELWLVMKLLSGGS
  • KKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEG

Post-translational modifications for OXSR1 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for OXSR1 Gene

Antibody Products

  • Cell Signaling Technology (CST) Antibodies for OXSR1 (OSR1)
  • Abcam antibodies for OXSR1

Domains & Families for OXSR1 Gene

Gene Families for OXSR1 Gene

IUPHAR :
Human Protein Atlas (HPA):
  • Enzymes
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for OXSR1 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

O95747

UniProtKB/Swiss-Prot:

OXSR1_HUMAN :
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
genes like me logo Genes that share domains with OXSR1: view

Function for OXSR1 Gene

Molecular function for OXSR1 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
By autophosphorylation on threonine.
UniProtKB/Swiss-Prot Function:
Regulates downstream kinases in response to environmental stress. May also have a function in regulating the actin cytoskeleton.

Enzyme Numbers (IUBMB) for OXSR1 Gene

Phenotypes From GWAS Catalog for OXSR1 Gene

Gene Ontology (GO) - Molecular Function for OXSR1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding IDA 14707132
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IDA,TAS 14707132
GO:0004702 signal transducer, downstream of receptor, with serine/threonine kinase activity IEA --
GO:0005515 protein binding IPI 17721439
genes like me logo Genes that share ontologies with OXSR1: view
genes like me logo Genes that share phenotypes with OXSR1: view

Animal Models for OXSR1 Gene

MGI Knock Outs for OXSR1:

Animal Model Products

  • Taconic Biosciences Mouse Models for OXSR1

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for OXSR1
  • Applied Biological Materials Clones for OXSR1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for OXSR1 Gene

Localization for OXSR1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for OXSR1 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for OXSR1 gene
Compartment Confidence
extracellular 5
cytosol 5
nucleus 2

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for OXSR1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IEA --
GO:0005737 cytoplasm IBA --
GO:0005829 cytosol IDA --
GO:0070062 extracellular exosome IDA 19056867
genes like me logo Genes that share ontologies with OXSR1: view

Pathways & Interactions for OXSR1 Gene

genes like me logo Genes that share pathways with OXSR1: view

Pathways by source for OXSR1 Gene

1 Cell Signaling Technology pathway for OXSR1 Gene
1 PharmGKB pathway for OXSR1 Gene

SIGNOR curated interactions for OXSR1 Gene

Activates:
Is activated by:

Gene Ontology (GO) - Biological Process for OXSR1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA,IDA 14707132
GO:0006979 response to oxidative stress IEA,TAS --
GO:0007346 regulation of mitotic cell cycle IBA --
GO:0016310 phosphorylation IEA --
GO:0018107 peptidyl-threonine phosphorylation IDA 24393035
genes like me logo Genes that share ontologies with OXSR1: view

Drugs & Compounds for OXSR1 Gene

(6) Drugs for OXSR1 Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
ATP Nutra Agonist 0
Magnesium Nutra 0

(4) Additional Compounds for OXSR1 Gene - From: HMDB and Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
ADP
  • Adenosindiphosphorsaeure
  • Adenosine 5'-pyrophosphate
  • Adenosine diphosphate
  • Adenosine pyrophosphate
  • Adenosine-5'-diphosphate
Full agonist, Agonist 58-64-0
Chloride ion
  • Bertholite
  • Chloor
  • Chlor
  • Chlore
  • Chloride
16887-00-6
genes like me logo Genes that share compounds with OXSR1: view

Transcripts for OXSR1 Gene

Unigene Clusters for OXSR1 Gene

Oxidative-stress responsive 1:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for OXSR1
  • Applied Biological Materials Clones for OXSR1
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for OXSR1 Gene

No ASD Table

Relevant External Links for OXSR1 Gene

GeneLoc Exon Structure for
OXSR1
ECgene alternative splicing isoforms for
OXSR1

Expression for OXSR1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for OXSR1 Gene

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for OXSR1 Gene



Protein tissue co-expression partners for OXSR1 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of OXSR1 Gene:

OXSR1

SOURCE GeneReport for Unigene cluster for OXSR1 Gene:

Hs.475970

mRNA Expression by UniProt/SwissProt for OXSR1 Gene:

O95747-OXSR1_HUMAN
Tissue specificity: Ubiquitously expressed in all tissue examined.

Evidence on tissue expression from TISSUES for OXSR1 Gene

  • Liver(4.2)
  • Kidney(2.2)
genes like me logo Genes that share expression patterns with OXSR1: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues and Phenotype-based relationships between genes and organs from Gene ORGANizer for OXSR1 Gene

Orthologs for OXSR1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for OXSR1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia OXSR1 33 34
  • 99.75 (n)
dog
(Canis familiaris)
Mammalia OXSR1 33 34
  • 93.99 (n)
cow
(Bos Taurus)
Mammalia OXSR1 33 34
  • 93.04 (n)
rat
(Rattus norvegicus)
Mammalia Oxsr1 33
  • 90.58 (n)
mouse
(Mus musculus)
Mammalia Oxsr1 33 16 34
  • 90.51 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia OXSR1 34
  • 88 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia OXSR1 34
  • 73 (a)
OneToOne
chicken
(Gallus gallus)
Aves OXSR1 33 34
  • 81.4 (n)
lizard
(Anolis carolinensis)
Reptilia OXSR1 34
  • 88 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia stk39 33
  • 75.37 (n)
Str.5309 33
African clawed frog
(Xenopus laevis)
Amphibia Xl.12346 33
zebrafish
(Danio rerio)
Actinopterygii oxsr1a 34
  • 82 (a)
OneToMany
oxsr1b 34
  • 82 (a)
OneToMany
zgc55494 33
fruit fly
(Drosophila melanogaster)
Insecta fray 33 34
  • 56.8 (n)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006715 33
  • 54.04 (n)
worm
(Caenorhabditis elegans)
Secernentea gck-3 34 33
  • 58.97 (n)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes SKM1 34
  • 16 (a)
ManyToMany
CLA4 34
  • 13 (a)
ManyToMany
rice
(Oryza sativa)
Liliopsida Os.18600 33
sea squirt
(Ciona savignyi)
Ascidiacea CSA.9457 34
  • 61 (a)
OneToMany
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.5075 33
Species where no ortholog for OXSR1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for OXSR1 Gene

ENSEMBL:
Gene Tree for OXSR1 (if available)
TreeFam:
Gene Tree for OXSR1 (if available)

Paralogs for OXSR1 Gene

Paralogs for OXSR1 Gene

genes like me logo Genes that share paralogs with OXSR1: view

Variants for OXSR1 Gene

Sequence variations from dbSNP and Humsavar for OXSR1 Gene

SNP ID Clin Chr 03 pos Sequence Context AA Info Type
VAR_040969 A metastatic melanoma sample
rs1000033372 -- 38,238,126(+) AATAC(A/G)TTGGT intron-variant
rs1000047977 -- 38,250,509(+) TCCTC(A/C)GACAG intron-variant
rs1000071933 -- 38,230,911(+) TGTCC(A/G)TGATA intron-variant
rs1000104424 -- 38,212,872(+) AGATA(C/T)TTAGT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for OXSR1 Gene

Variant ID Type Subtype PubMed ID
esv274896 CNV loss 21479260
esv3568700 CNV loss 25503493
esv3595905 OTHER inversion 21293372
nsv3768 CNV insertion 18451855

Variation tolerance for OXSR1 Gene

Residual Variation Intolerance Score: 21.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 8.02; 84.24% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for OXSR1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
OXSR1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for OXSR1 Gene

Disorders for OXSR1 Gene

Relevant External Links for OXSR1

Human Genome Epidemiology (HuGE) Navigator
OXSR1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
OXSR1

No disorders were found for OXSR1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for OXSR1 Gene

Publications for OXSR1 Gene

  1. Isolation and characterization of a novel serine threonine kinase gene on chromosome 3p22-21.3. (PMID: 10083736) Tamari M … Nakamura Y (Journal of human genetics 1999) 2 3 4 60
  2. Activation of the thiazide-sensitive Na+-Cl- cotransporter by the WNK-regulated kinases SPAK and OSR1. (PMID: 18270262) Richardson C … Alessi DR (Journal of cell science 2008) 3 22 60
  3. Structural insights into the recognition of substrates and activators by the OSR1 kinase. (PMID: 17721439) Villa F … van Aalten DM (EMBO reports 2007) 3 22 60
  4. Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. (PMID: 17081983) Olsen JV … Mann M (Cell 2006) 3 4 60
  5. WNK1 and OSR1 regulate the Na+, K+, 2Cl- cotransporter in HeLa cells. (PMID: 16832045) Anselmo AN … Cobb MH (Proceedings of the National Academy of Sciences of the United States of America 2006) 3 22 60

Products for OXSR1 Gene

  • Addgene plasmids for OXSR1

Sources for OXSR1 Gene

Content
Loading form....