Free for academic non-profit institutions. Other users need a Commercial license

Aliases for OGDHL Gene

Aliases for OGDHL Gene

  • Oxoglutarate Dehydrogenase Like 2 3 5
  • 2-Oxoglutarate Dehydrogenase Complex Component E1-Like 3 4
  • Alpha-Ketoglutarate Dehydrogenase-Like 3 4
  • OGDC-E1-Like 3 4
  • 2-Oxoglutarate Dehydrogenase-Like, Mitochondrial 3
  • EC 1.2.4.2 58
  • EC 1.2.4.- 4
  • KIAA1290 4

External Ids for OGDHL Gene

Previous GeneCards Identifiers for OGDHL Gene

  • GC10M050288
  • GC10M050612
  • GC10M050942
  • GC10M045207

Summaries for OGDHL Gene

Entrez Gene Summary for OGDHL Gene

  • The protein encoded by this gene is similar to oxoglutarate dehydrogenase (OGDH) of the OGDH complex, which degrades glucose and glutamate. This gene encodes several isoforms, including some that appear to localize to mitochondria. The encoded protein down-regulates the AKT signaling cascade and can suppress the growth of cervical cancer cells. [provided by RefSeq, Dec 2016]

GeneCards Summary for OGDHL Gene

OGDHL (Oxoglutarate Dehydrogenase Like) is a Protein Coding gene. Among its related pathways are Metabolism and Lysine degradation. GO annotations related to this gene include oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor and oxoglutarate dehydrogenase (succinyl-transferring) activity. An important paralog of this gene is OGDH.

Additional gene information for OGDHL Gene

No data available for CIViC summary , UniProtKB/Swiss-Prot , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for OGDHL Gene

Genomics for OGDHL Gene

Regulatory Elements for OGDHL Gene

Enhancers for OGDHL Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH10H049762 1.1 ENCODE 22.1 0.0 -1 0 MLX ZFP64 ARID4B SIN3A SLC30A9 ZNF766 ZNF143 SP3 SP5 ZHX2 OGDHL LINC00843 AGAP6 ERCC6 WASHC2A RNA5SP317 MAPK6PS6 GC10M049685
GH10H049690 0.4 ENCODE 10.8 +72.0 72010 0 POLR2A POU5F1 OGDHL MAPK6PS6 CHAT SLC18A3 GC10M049685 C10orf53
GH10H049689 0.4 ENCODE 10.8 +72.3 72310 0 POLR2A OGDHL MAPK6PS6 SLC18A3 CHAT GC10M049685 C10orf53
GH10H049701 0.5 ENCODE 6.1 +61.2 61170 0 CTCF ZNF341 GLIS1 OGDHL GC10M049685 C10orf53
GH10H049734 0.6 ENCODE 0.3 +27.6 27600 0 SMARCE1 DPF2 FOXA1 JUND GATA3 CTBP1 FOS TCF7L2 OGDHL GC10M049685
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around OGDHL on UCSC Golden Path with GeneCards custom track

Promoters for OGDHL Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000027918 179 801 MLX ZFP64 ARID4B SIN3A SLC30A9 ZNF766 ZNF143 SP3 SP5 ZHX2

Genomic Location for OGDHL Gene

Chromosome:
10
Start:
49,734,641 bp from pter
End:
49,762,379 bp from pter
Size:
27,739 bases
Orientation:
Minus strand

Genomic View for OGDHL Gene

Genes around OGDHL on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
OGDHL Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for OGDHL Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for OGDHL Gene

Proteins for OGDHL Gene

  • Protein details for OGDHL Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9ULD0-OGDHL_HUMAN
    Recommended name:
    2-oxoglutarate dehydrogenase-like, mitochondrial
    Protein Accession:
    Q9ULD0
    Secondary Accessions:
    • A8K2G1
    • B4DKG2
    • B4E193
    • Q8TAN9
    • Q9NVA0

    Protein attributes for OGDHL Gene

    Size:
    1010 amino acids
    Molecular mass:
    114481 Da
    Cofactor:
    Name=thiamine diphosphate; Xref=ChEBI:CHEBI:58937;
    Quaternary structure:
    No Data Available
    SequenceCaution:
    • Sequence=BAA86604.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};

    Alternative splice isoforms for OGDHL Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for OGDHL Gene

Selected DME Specific Peptides for OGDHL Gene

Q9ULD0:
  • RLSGQDV
  • GQAKWVR
  • KSLLRHP
  • VVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVN
  • GPEHSSAR
  • GKTKAEQFY
  • GMPHRGRLNVLANV
  • LPTTTFIGG
  • HLAVQSLIRAYQIRGHHVAQLDPLGILDADLDS
  • LREIIRRLE
  • GTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPI
  • QLYDCNW
  • EGSGDVKYHLG
  • RKWSSEKRFGLEGCEV
  • FQRVIPE
  • RRQILLPFRKPLI
  • TPKSLLR
  • LSLVANPSHLE
  • RTVDWALAEYM
  • VLGFELG
  • VANPSHLEAVDPVV
  • DLVCYRR
  • RGTFSHRH
  • DCNWIVVNCS
  • KLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLD
  • FCTGKVYY
  • GRDPAAAPATGN
  • DEPMFTQPLMY
  • SVHKSWD

Post-translational modifications for OGDHL Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for OGDHL Gene

Gene Families for OGDHL Gene

Human Protein Atlas (HPA):
  • Predicted intracellular proteins

Suggested Antigen Peptide Sequences for OGDHL Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9ULD0

UniProtKB/Swiss-Prot:

OGDHL_HUMAN :
  • Belongs to the alpha-ketoglutarate dehydrogenase family.
Family:
  • Belongs to the alpha-ketoglutarate dehydrogenase family.
genes like me logo Genes that share domains with OGDHL: view

Function for OGDHL Gene

Molecular function for OGDHL Gene

GENATLAS Biochemistry:
alpha-ketoglutarate dehydrogenase,E1k subunit-like sequence

Enzyme Numbers (IUBMB) for OGDHL Gene

Gene Ontology (GO) - Molecular Function for OGDHL Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004591 oxoglutarate dehydrogenase (succinyl-transferring) activity IBA --
GO:0005515 protein binding IPI 21988832
GO:0016491 oxidoreductase activity IEA --
GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor IEA --
GO:0030976 thiamine pyrophosphate binding IEA --
genes like me logo Genes that share ontologies with OGDHL: view
genes like me logo Genes that share phenotypes with OGDHL: view

Animal Model Products

  • Taconic Biosciences Mouse Models for OGDHL

CRISPR Products

miRNA for OGDHL Gene

miRTarBase miRNAs that target OGDHL

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for OGDHL
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Phenotypes From GWAS Catalog , Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for OGDHL Gene

Localization for OGDHL Gene

Subcellular locations from UniProtKB/Swiss-Prot for OGDHL Gene

Mitochondrion matrix.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for OGDHL gene
Compartment Confidence
mitochondrion 5
nucleus 2
cytosol 2

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Nucleoli fibrillar center (2)
  • Nucleus (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for OGDHL Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IBA --
GO:0005759 mitochondrial matrix IEA --
GO:0005829 NOT cytosol IBA --
GO:0045252 oxoglutarate dehydrogenase complex IBA --
genes like me logo Genes that share ontologies with OGDHL: view

Pathways & Interactions for OGDHL Gene

genes like me logo Genes that share pathways with OGDHL: view

Pathways by source for OGDHL Gene

Gene Ontology (GO) - Biological Process for OGDHL Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006096 glycolytic process IEA --
GO:0006099 tricarboxylic acid cycle IBA --
GO:0008152 metabolic process IEA --
GO:0055114 oxidation-reduction process IEA --
genes like me logo Genes that share ontologies with OGDHL: view

No data available for SIGNOR curated interactions for OGDHL Gene

Drugs & Compounds for OGDHL Gene

(6) Drugs for OGDHL Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Carbon dioxide Approved, Vet_approved Pharma 0
2-Ketobutyric acid Experimental Pharma 0
Succinyl-CoA Experimental Pharma 0
NAD Pharma Full agonist, Agonist 0
Coenzyme A Nutra 0

(7) Additional Compounds for OGDHL Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
3-Carboxy-1-hydroxypropylthiamine diphosphate
  • 2-(3-Carboxy-1-hydroxypropyl)thiamine diphosphate
  • 3-Carboxy-1-hydroxypropyl-ThPP
  • 3-[(4-Amino-2-methylpyrimidin-5-yl)methyl]-2-(3-carboxy-1-hydroxypropyl)-5-(2-diphosphoethyl)-4-methyl-1,3-thiazol-3-ium
Glutaryl-coa
  • Glutaryl-CoA
  • Glutaryl-coenzyme A
103192-48-9
Hydrogen Ion
  • Hydrogen cation
  • Hydron
  • Proton
Oxoadipic acid
  • 2-Keto-adipate
  • 2-Ketoadipate
  • 2-Ketoadipic acid
  • 2-Oxo-hexanedioate
  • 2-Oxo-hexanedioic acid
3184-35-8
Oxoglutaric acid
  • 2-Ketoglutarate
  • 2-Ketoglutaric acid
  • 2-Oxo-1,5-pentanedioate
  • 2-Oxo-1,5-pentanedioic acid
  • 2-Oxoglutarate
328-50-7
genes like me logo Genes that share compounds with OGDHL: view

Transcripts for OGDHL Gene

Unigene Clusters for OGDHL Gene

Oxoglutarate dehydrogenase-like:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for OGDHL
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for OGDHL Gene

ExUns: 1a · 1b ^ 2a · 2b ^ 3 ^ 4 ^ 5a · 5b ^ 6a · 6b · 6c · 6d · 6e · 6f ^ 7 ^ 8a · 8b · 8c ^ 9 ^ 10a · 10b ^ 11a · 11b ^ 12a · 12b ^ 13a ·
SP1: - - - - - - -
SP2:
SP3:
SP4: - - - - - - - - -
SP5: - - - - - - -
SP6: - - - - - - - - - - -
SP7: - - - - -
SP8:
SP9: - - - - - - - -
SP10: - - -
SP11:
SP12:
SP13: - - -
SP14: - - - -
SP15: - - -
SP16: - - -
SP17:

ExUns: 13b ^ 14 ^ 15 ^ 16 ^ 17a · 17b ^ 18 ^ 19 ^ 20a · 20b ^ 21 ^ 22a · 22b ^ 23 ^ 24 ^ 25a · 25b · 25c ^ 26 ^ 27a · 27b · 27c · 27d
SP1: - -
SP2: -
SP3: -
SP4:
SP5:
SP6:
SP7:
SP8: -
SP9:
SP10:
SP11:
SP12:
SP13:
SP14:
SP15:
SP16:
SP17:

Relevant External Links for OGDHL Gene

GeneLoc Exon Structure for
OGDHL
ECgene alternative splicing isoforms for
OGDHL

Expression for OGDHL Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for OGDHL Gene

mRNA differential expression in normal tissues according to GTEx for OGDHL Gene

This gene is overexpressed in Kidney - Cortex (x8.8) and Liver (x6.0).

Protein differential expression in normal tissues from HIPED for OGDHL Gene

This gene is overexpressed in Bone marrow mesenchymal stem cell (24.2), Brain (16.9), and Frontal cortex (10.0).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for OGDHL Gene



NURSA nuclear receptor signaling pathways regulating expression of OGDHL Gene:

OGDHL

SOURCE GeneReport for Unigene cluster for OGDHL Gene:

Hs.17860

Evidence on tissue expression from TISSUES for OGDHL Gene

  • Nervous system(5)
  • Kidney(4.5)
  • Liver(4.4)
genes like me logo Genes that share expression patterns with OGDHL: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein tissue co-expression partners , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for OGDHL Gene

Orthologs for OGDHL Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for OGDHL Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia OGDHL 33 34
  • 96.07 (n)
dog
(Canis familiaris)
Mammalia OGDHL 33 34
  • 90.56 (n)
cow
(Bos Taurus)
Mammalia OGDHL 33 34
  • 90.13 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia OGDHL 34
  • 88 (a)
OneToOne
rat
(Rattus norvegicus)
Mammalia Ogdhl 33
  • 87.92 (n)
mouse
(Mus musculus)
Mammalia Ogdhl 33 16 34
  • 87.62 (n)
oppossum
(Monodelphis domestica)
Mammalia OGDHL 34
  • 87 (a)
OneToOne
chicken
(Gallus gallus)
Aves OGDHL 33 34
  • 74.51 (n)
lizard
(Anolis carolinensis)
Reptilia OGDHL 34
  • 83 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia ogdhl 33
  • 72.82 (n)
zebrafish
(Danio rerio)
Actinopterygii OGDHL 34
  • 78 (a)
OneToOne
ogdhl 33
  • 73.1 (n)
fruit fly
(Drosophila melanogaster)
Insecta Nc73EF 34
  • 56 (a)
ManyToMany
CG33791 34
  • 42 (a)
ManyToMany
worm
(Caenorhabditis elegans)
Secernentea ogdh-1 34
  • 55 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes KGD1 34
  • 44 (a)
OneToMany
barley
(Hordeum vulgare)
Liliopsida Hv.506 33
rice
(Oryza sativa)
Liliopsida Os.13926 33
wheat
(Triticum aestivum)
Liliopsida Ta.2604 33
sea squirt
(Ciona savignyi)
Ascidiacea CSA.7934 34
  • 63 (a)
OneToMany
sea squirt
(Ciona intestinalis)
Ascidiacea Cin.4680 33
Species where no ortholog for OGDHL was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)

Evolution for OGDHL Gene

ENSEMBL:
Gene Tree for OGDHL (if available)
TreeFam:
Gene Tree for OGDHL (if available)

Paralogs for OGDHL Gene

Paralogs for OGDHL Gene

(2) SIMAP similar genes for OGDHL Gene using alignment to 1 proteins:

genes like me logo Genes that share paralogs with OGDHL: view

Variants for OGDHL Gene

Sequence variations from dbSNP and Humsavar for OGDHL Gene

SNP ID Clin Chr 10 pos Sequence Context AA Info Type
rs150231967 Likely pathogenic 49,750,849(+) TGGCA(A/T)CCCCA nc-transcript-variant, reference, missense, utr-variant-5-prime
rs143105288 Uncertain significance 49,739,779(+) CCCCA(A/G)ACTGG nc-transcript-variant, reference, missense
rs1000193385 -- 49,746,156(+) TCCCA(C/T)GGGGA intron-variant
rs1000211187 -- 49,746,343(+) TTCCC(A/T)CCTCA intron-variant
rs1000431619 -- 49,741,261(+) GCCCT(C/G)TCCCA intron-variant

Structural Variations from Database of Genomic Variants (DGV) for OGDHL Gene

Variant ID Type Subtype PubMed ID
esv2588189 CNV insertion 19546169
esv3401087 CNV duplication 20981092
nsv1042677 CNV loss 25217958
nsv1048905 CNV gain 25217958

Variation tolerance for OGDHL Gene

Residual Variation Intolerance Score: 19.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 5.66; 72.84% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for OGDHL Gene

Human Gene Mutation Database (HGMD)
OGDHL
SNPedia medical, phenotypic, and genealogical associations of SNPs for
OGDHL

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for OGDHL Gene

Disorders for OGDHL Gene

Relevant External Links for OGDHL

Genetic Association Database (GAD)
OGDHL
Human Genome Epidemiology (HuGE) Navigator
OGDHL
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
OGDHL

No disorders were found for OGDHL Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for OGDHL Gene

Publications for OGDHL Gene

  1. Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10574462) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1999) 2 3 4 60
  2. Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals. (PMID: 19851296) Oguri M … Yamada Y (American journal of hypertension 2010) 3 45 60
  3. Association of genetic variants with hemorrhagic stroke in Japanese individuals. (PMID: 20198315) Yoshida T … Yamada Y (International journal of molecular medicine 2010) 3 45 60
  4. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 45 60
  5. Association of gene polymorphisms with chronic kidney disease in Japanese individuals. (PMID: 19724895) Yoshida T … Yamada Y (International journal of molecular medicine 2009) 3 45 60

Products for OGDHL Gene

Sources for OGDHL Gene

Content
Loading form....