Free for academic non-profit institutions. Other users need a Commercial license

Aliases for NRDC Gene

Aliases for NRDC Gene

  • Nardilysin Convertase 2 3 4 5
  • Nardilysin (N-Arginine Dibasic Convertase) 2 3
  • N-Arginine Dibasic Convertase 2 4
  • NRD Convertase 3 4
  • EC 3.4.24.61 4 61
  • NRD1 3 4
  • Nardilysin 3
  • EC 3.4.24 61
  • HNRD1 3
  • HNRD2 3
  • NRD-C 4

External Ids for NRDC Gene

Previous HGNC Symbols for NRDC Gene

  • NRD1

Summaries for NRDC Gene

Entrez Gene Summary for NRDC Gene

  • This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

GeneCards Summary for NRDC Gene

NRDC (Nardilysin Convertase) is a Protein Coding gene. An important paralog of this gene is IDE.

UniProtKB/Swiss-Prot for NRDC Gene

  • Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Gene Wiki entry for NRDC Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for NRDC Gene

Genomics for NRDC Gene

Regulatory Elements for NRDC Gene

Enhancers for NRDC Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01G051563 1.7 Ensembl ENCODE dbSUPER 15.7 +310.9 310920 9.3 CREB3L1 MLX AGO1 DMAP1 YY1 SLC30A9 NFYC ZFP41 ZNF610 GLIS1 NRDC ZCCHC11 RNU6-1281P ENSG00000266993 EPS15 ENSG00000227070 KTI12 RNU6-877P CALR4P OSBPL9
GH01G051642 1.3 FANTOM5 Ensembl ENCODE 14.5 +235.1 235137 3.5 PKNOX1 JUN ZNF384 RAD21 CTBP1 ZNF366 ZSCAN5C PRDM10 FOS KLF8 NRDC OSBPL9 ENSG00000212624 RNU6-877P LOC105378719 GAPDHP51
GH01G051874 1.7 FANTOM5 ENCODE dbSUPER 11 +1.5 1471 5.3 MLX CREB3L1 DMAP1 YY1 ZNF143 ZNF548 ZNF263 SP3 NFYC TBX21 ENSG00000266993 ZCCHC11 TXNDC12 NRDC KTI12 CC2D1B OSBPL9 GC01P051865
GH01G051736 1.1 Ensembl ENCODE 10.6 +142.0 142019 0.6 HDGF PKNOX1 TBL1XR1 NFIB ARNT FEZF1 ZBTB40 CHAMP1 ZNF766 FOS NRDC GC01P051733 ENSG00000266993
GH01G051728 1.1 ENCODE 10.4 +149.0 149031 3.4 PKNOX1 CREB3L1 ARNT WRNIP1 ARID4B SIN3A DMAP1 ZNF2 ZBTB7B SLC30A9 TXNDC12 NRDC KTI12 RNU6-877P OSBPL9 GC01P051732 ENSG00000212624
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around NRDC on UCSC Golden Path with GeneCards custom track

Promoters for NRDC Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000006342 637 2601 MLX CREB3L1 DMAP1 YY1 ZNF143 ZNF548 ZNF263 SP3 NFYC TBX21

Genomic Location for NRDC Gene

Chromosome:
1
Start:
51,789,191 bp from pter
End:
51,878,937 bp from pter
Size:
89,747 bases
Orientation:
Minus strand

Genomic View for NRDC Gene

Genes around NRDC on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
NRDC Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for NRDC Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for NRDC Gene

Proteins for NRDC Gene

  • Protein details for NRDC Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O43847-NRDC_HUMAN
    Recommended name:
    Nardilysin
    Protein Accession:
    O43847
    Secondary Accessions:
    • A6NI41
    • O15241
    • O15242
    • Q5VUL0
    • Q96HB2
    • Q9NU57

    Protein attributes for NRDC Gene

    Size:
    1150 amino acids
    Molecular mass:
    131572 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    No Data Available

    Alternative splice isoforms for NRDC Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for NRDC Gene

Selected DME Specific Peptides for NRDC Gene

O43847:
  • NILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK
  • SAANVVLFDIF
  • GHEGKGSILS

Post-translational modifications for NRDC Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for NRDC Gene

Graphical View of Domain Structure for InterPro Entry

O43847

UniProtKB/Swiss-Prot:

NRDC_HUMAN :
  • Belongs to the peptidase M16 family.
Family:
  • Belongs to the peptidase M16 family.
genes like me logo Genes that share domains with NRDC: view

No data available for Gene Families for NRDC Gene

Function for NRDC Gene

Molecular function for NRDC Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Hydrolysis of polypeptides, preferably at -Xaa- -Arg-Lys-, and less commonly at -Arg- -Arg-Xaa-, in which Xaa is not Arg or Lys.
UniProtKB/Swiss-Prot Function:
Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Enzyme Numbers (IUBMB) for NRDC Gene

Gene Ontology (GO) - Molecular Function for NRDC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004222 metalloendopeptidase activity IEA,NAS 9581555
GO:0005515 protein binding IPI 18355445
GO:0008233 peptidase activity IEA --
GO:0008237 metallopeptidase activity IEA --
GO:0016787 hydrolase activity IEA --
genes like me logo Genes that share ontologies with NRDC: view
genes like me logo Genes that share phenotypes with NRDC: view

Animal Models for NRDC Gene

MGI Knock Outs for NRDC:

Animal Model Products

  • Taconic Biosciences Mouse Models for NRDC

Inhibitory RNA Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for NRDC Gene

Localization for NRDC Gene

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for NRDC gene
Compartment Confidence
mitochondrion 5
cytosol 5
nucleus 3

Gene Ontology (GO) - Cellular Components for NRDC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IEA,IDA 28017472
GO:0005829 cytosol TAS 12463163
GO:0009986 cell surface TAS 12463163
genes like me logo Genes that share ontologies with NRDC: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot for NRDC Gene

Pathways & Interactions for NRDC Gene

No Data Available

Gene Ontology (GO) - Biological Process for NRDC Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis NAS,IEA 9581555
GO:0007528 neuromuscular junction development TAS 9479496
GO:0008283 cell proliferation TAS 12463163
GO:0016477 cell migration TAS 15544571
GO:0051044 positive regulation of membrane protein ectodomain proteolysis IDA 18355445
genes like me logo Genes that share ontologies with NRDC: view

No data available for Pathways by source and SIGNOR curated interactions for NRDC Gene

Drugs & Compounds for NRDC Gene

(2) Drugs for NRDC Gene - From: Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
genes like me logo Genes that share compounds with NRDC: view

Transcripts for NRDC Gene

Inhibitory RNA Products

Alternative Splicing Database (ASD) splice patterns (SP) for NRDC Gene

No ASD Table

Relevant External Links for NRDC Gene

GeneLoc Exon Structure for
NRDC
ECgene alternative splicing isoforms for
NRDC

Expression for NRDC Gene

NURSA nuclear receptor signaling pathways regulating expression of NRDC Gene:

NRDC

mRNA Expression by UniProt/SwissProt for NRDC Gene:

O43847-NRDC_HUMAN
Tissue specificity: Primarily in adult heart, skeletal muscle, and testis and at much lower levels in other tissues.

Evidence on tissue expression from TISSUES for NRDC Gene

  • Nervous system(4.7)
  • Liver(4.4)
  • Heart(4.3)
  • Skin(3)
  • Lung(2.9)
  • Muscle(2)

Primer Products

No data available for mRNA expression in normal human tissues , mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , Protein differential expression in normal tissues , Protein expression , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for NRDC Gene

Orthologs for NRDC Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for NRDC Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia NRD1 35 34
  • 99.59 (n)
OneToOne
cow
(Bos Taurus)
Mammalia NRD1 34 35
  • 93.96 (n)
dog
(Canis familiaris)
Mammalia NRD1 35 34
  • 93.6 (n)
OneToOne
mouse
(Mus musculus)
Mammalia Nrd1 35 16 34
  • 90.59 (n)
OneToOne
rat
(Rattus norvegicus)
Mammalia Nrd1 34
  • 89.24 (n)
oppossum
(Monodelphis domestica)
Mammalia NRD1 35
  • 83 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia NRD1 35
  • 75 (a)
OneToOne
chicken
(Gallus gallus)
Aves NRD1 35 34
  • 75.63 (n)
OneToOne
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 70 (a)
OneToMany
-- 35
  • 64 (a)
OneToMany
tropical clawed frog
(Silurana tropicalis)
Amphibia nrd1 34
  • 66.27 (n)
zebrafish
(Danio rerio)
Actinopterygii NRD1 (1 of 2) 35
  • 69 (a)
OneToMany
si:dkey-193b15.9 34
  • 68 (n)
nrd1 35
  • 64 (a)
OneToMany
wufk24c07 34
fruit fly
(Drosophila melanogaster)
Insecta CG10588 35
  • 31 (a)
OneToMany
CG2025 35
  • 31 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes STE23 35
  • 27 (a)
OneToMany
thale cress
(Arabidopsis thaliana)
eudicotyledons AT1G06900 34
  • 47.34 (n)
rice
(Oryza sativa)
Liliopsida Os03g0336300 34
  • 47.87 (n)
Species where no ortholog for NRDC was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for NRDC Gene

ENSEMBL:
Gene Tree for NRDC (if available)
TreeFam:
Gene Tree for NRDC (if available)

Paralogs for NRDC Gene

Paralogs for NRDC Gene

genes like me logo Genes that share paralogs with NRDC: view

Variants for NRDC Gene

Sequence variations from dbSNP and Humsavar for NRDC Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs1000009422 -- 51,843,977(+) TCTAC(C/T)ATCAA intron-variant
rs1000039176 -- 51,832,498(+) GCAGA(C/T)GTATC intron-variant
rs1000055976 -- 51,835,111(+) GGTTG(A/G)AGTGC intron-variant
rs1000137268 -- 51,846,176(+) GTGCC(A/G/T)TCTCG intron-variant
rs1000152468 -- 51,857,975(+) TAAGG(C/T)AGAAT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for NRDC Gene

Variant ID Type Subtype PubMed ID
dgv82n106 CNV deletion 24896259
esv1546529 CNV insertion 17803354
esv1684865 CNV insertion 17803354
esv2551965 CNV insertion 19546169
esv3349028 CNV insertion 20981092
esv3586044 CNV gain 21293372
nsv1110660 CNV insertion 24896259
nsv512738 CNV insertion 21212237
nsv519495 CNV loss 19592680
nsv829837 CNV loss 17160897
nsv956714 CNV insertion 24416366

Variation tolerance for NRDC Gene

Residual Variation Intolerance Score: 3.39% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 2.48; 43.56% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for NRDC Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
NRDC

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for NRDC Gene

Disorders for NRDC Gene

Relevant External Links for NRDC

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
NRDC

No disorders were found for NRDC Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for NRDC Gene

Publications for NRDC Gene

  1. Human NRD convertase: a highly conserved metalloendopeptidase expressed at specific sites during development and in adult tissues. (PMID: 9479496) Fumagalli P. … Taramelli R. (Genomics 1998) 2 3 4 22 64
  2. Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family. (PMID: 9581555) Hospital V. … Cohen P. (Biochem. J. 1997) 2 3 4 22 64
  3. Gene expression of the dibasic-pair cleaving enzyme NRD convertase (N-arginine dibasic convertase) is differentially regulated in the GH3 pituitary and Mat-Lu prostate cell lines. (PMID: 11042131) Winter A.G. … Pierotti A.R. (Biochem. J. 2000) 3 4 22 64
  4. Ectodomain shedding of TNF-alpha is enhanced by nardilysin via activation of ADAM proteases. (PMID: 18355445) Hiraoka Y. … Nishi E. (Biochem. Biophys. Res. Commun. 2008) 3 22 64
  5. Histochemical evidence for wide expression of the metalloendopeptidase nardilysin in human brain neurons. (PMID: 17442499) Bernstein H.G. … Reiser G. (Neuroscience 2007) 3 22 64

Products for NRDC Gene

Sources for NRDC Gene

Content
Loading form....