Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 



NRD1 Gene

protein-coding   GIFtS: 61
GCID: GC01M052254

Nardilysin (N-Arginine Dibasic Convertase)

Alzheimer's & Parkinson's Diseases Congress
  See related diseases
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

TryGeneCards Plus

Aliases
Nardilysin (N-Arginine Dibasic Convertase)1 2     hNRD22
NRD-C2 3     nardilysin2
NRD Convertase2 3     N-Arginine Dibasic Convertase3
EC 3.4.24.613 8     EC 3.4.248
hNRD12     

External Ids:    HGNC: 79951   Entrez Gene: 48982   Ensembl: ENSG000000786187   OMIM: 6026515   UniProtKB: O438473   

Export aliases for NRD1 gene to outside databases

Previous GC identifers: GC01M051848 GC01M051143 GC01M051613 GC01M051624 GC01M051966 GC01M052028 GC01M050371


(According to Entrez Gene, GeneCards, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

TryGeneCards Plus

Entrez Gene summary for NRD1 Gene:
This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine
residues in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with
heparin-binding EGF-like growth factor and plays a role in cell migration and proliferation. Multiple transcript
variants encoding different isoforms have been found for this gene. (provided by RefSeq, May 2011)

GeneCards Summary for NRD1 Gene:
NRD1 (nardilysin (N-arginine dibasic convertase)) is a protein-coding gene. Diseases associated with NRD1 include differentiating neuroblastoma, and neuroblastoma. GO annotations related to this gene include epidermal growth factor binding and metalloendopeptidase activity. An important paralog of this gene is IDE.

UniProtKB/Swiss-Prot: NRDC_HUMAN, O43847
Function: Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs

Gene Wiki entry for NRD1 Gene


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 75), Regulatory elements and Epigenetics data according to QIAGEN, and/or SwitchGear Genomics)
About This Section

TryGeneCards Plus
RefSeq DNA sequence:
NC_000001.11  NT_032977.10  NC_018912.2  
Regulatory elements:
   Regulatory transcription factor binding sites in the NRD1 gene promoter:
         CBF-B   CBF-A   NF-YA   FOXO3a   CP1C   CP1A   NF-Y   CBF-C   CBF(2)   FOXO3b   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidNRD1 promoter sequence
   Search Chromatin IP Primers for NRD1

Epigenetics:
DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat NRD1


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 1p32.2-p32.1   Ensembl cytogenetic band:  1p32.3   HGNC cytogenetic band: 1p32.2-p32.1

NRD1 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
NRD1 gene location

GeneLoc information about chromosome 1         GeneLoc Exon Structure

GeneLoc location for GC01M052254:  view genomic region     (about GC identifiers)

Start:
52,254,863 bp from pter      End:
52,344,609 bp from pter
Size:
89,747 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, 2neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Antibodies by EMD Millipore, R&D Systems, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

TryGeneCards Plus

UniProtKB/Swiss-Prot: NRDC_HUMAN, O43847 (See protein sequence)
Recommended Name: Nardilysin precursor  
Size: 1150 amino acids; 131572 Da
Cofactor: Binds 1 zinc ion per subunit (By similarity)
Secondary accessions: A6NI41 O15241 O15242 Q5VUL0 Q96HB2 Q9NU57
Alternative splicing: 2 isoforms:  O43847-1   O43847-2   

Explore the universe of human proteins at neXtProt for NRD1: NX_O43847

Explore proteomics data for NRD1 at MOPED

Post-translational modifications: 

  • Ubiquitination2 at Lys325, Lys341, Lys351
  • Modification sites at PhosphoSitePlus
  • 3 DME Specific Peptides for NRD1 (O43847)
     GHEGKGSILS  SAANVVLFDIF  NILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK 


    See NRD1 Protein Expression from SPIRE MOPED, PaxDB, and MaxQB

    REFSEQ proteins (3 alternative transcripts): 
    NP_001095132.1  NP_001229290.1  NP_002516.2  

    ENSEMBL proteins: 
     ENSP00000398464   ENSP00000262679   ENSP00000346890   ENSP00000444416   ENSP00000442262  

    NRD1 Human Recombinant Protein Products:

    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    OriGene Purified Protein for NRD1
    OriGene Protein Over-expression Lysate for NRD1
    OriGene MassSpec for NRD1
    OriGene Custom Protein Services for NRD1
    GenScript Custom Purified and Recombinant Proteins Services for NRD1
    Novus Biologicals NRD1 Protein
    Novus Biologicals NRD1 Lysate
    Browse Sino Biological Recombinant Proteins
    Browse Sino Biological Cell Lysates
    Browse ProSpec Recombinant Proteins
    Cloud-Clone Corp. Proteins for NRD1

    NRD1 Antibody Products:

    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for NRD1
    Novus Biologicals NRD1 Antibodies
    Abcam antibodies for NRD1
    Cloud-Clone Corp. Antibodies for NRD1
    ThermoFisher Antibodies for NRD1
    LSBio Antibodies in human, mouse, rat for NRD1

    NRD1 Assay Products:

    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for NRD1
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for NRD1
    Browse Enzo Life Sciences for kits & assays
    Cloud-Clone Corp. ELISAs for NRD1
    Cloud-Clone Corp. CLIAs for NRD1


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    TryGeneCards Plus
    5 InterPro protein domains:
     IPR001431 Pept_M16_Zn_BS
     IPR007863 Peptidase_M16_C
     IPR011765 Pept_M16_N
     IPR011249 Metalloenz_LuxS/M16
     IPR011237 Pept_M16_dom

    Graphical View of Domain Structure for InterPro Entry O43847

    ProtoNet protein and cluster: O43847

    1 Blocks protein domain: IPB001431 Insulinase-like peptidase

    UniProtKB/Swiss-Prot: NRDC_HUMAN, O43847
    Similarity: Belongs to the peptidase M16 family


    NRD1 for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    transcription factor targeting from QIAGEN and/or HOMER, miRNA Gene Targets from miRTarBase, shRNA from OriGene, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, SwitchGear Genomics, Gene Editing from DNA2.0, Clones from OriGene, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, ESI BIO, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: NRDC_HUMAN, O43847
    Function: Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs
    Catalytic activity: Hydrolysis of polypeptides, preferably at -Xaa- -Arg-Lys-, and less commonly at -Arg-
    -Arg-Xaa-, in which Xaa is not Arg or Lys

         Genatlas biochemistry entry for NRD1:
    nardilysin,N-arginine dibasic convertase,expressed in testis and in embryonic nervous system,involved in
    development

         Enzyme Numbers (IUBMB): EC 3.4.24.611 2 EC 3.4.242

         Gene Ontology (GO): 5 molecular function terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0003824catalytic activity ----
    GO:0004222metalloendopeptidase activity NAS9581555
    GO:0005515protein binding IPI18355445
    GO:0046872metal ion binding IEA--
    GO:0048408epidermal growth factor binding TAS12463163
         
    NRD1 for ontologies           About GeneDecksing


    Phenotypes:
         2 GenomeRNAi human phenotypes for NRD1:
     Increased Salmonella enterica   Synthetic lethal with Ras 

         4 MGI mutant phenotypes (inferred from 1 allele(MGI details for Nrd1):
     behavior/neurological  growth/size/body  mortality/aging  nervous system 

    NRD1 for phenotypes           About GeneDecksing

    Animal Models:
       inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for NRD1
       inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for NRD1

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for NRD1
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for NRD1

    miRNA
    Products:
        
    miRTarBase miRNAs that target NRD1:
    hsa-mir-26b-5p (MIRT029502), hsa-mir-181d-5p (MIRT041161), hsa-mir-125b-5p (MIRT046070), hsa-let-7b-5p (MIRT052237), hsa-mir-181b-5p (MIRT047224), hsa-mir-615-3p (MIRT040263)

    Block miRNA regulation of human, mouse, rat NRD1 using miScript Target Protectors
    Search for qRT-PCR Assays for microRNAs that regulate NRD1
    Browse SwitchGear 3'UTR luciferase reporter plasmids
    Inhib. RNA
    Products:
        
    OriGene RNAi products in human, mouse, rat for NRD1
    Predesigned siRNA for gene silencing in human, mouse, rat NRD1

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for NRD1

    Clone
    Products:
         
    OriGene clones in human, mouse for NRD1 (see all 13)
    OriGene ORF clones in mouse, rat for NRD1
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector (see all 2): NRD1 (NM_002525)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for NRD1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NRD1

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for NRD1
    Browse ESI BIO Cell Lines and PureStem Progenitors for NRD1 
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NRD1


    (According to UniProtKB, COMPARTMENTS Subcellular localization database, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene.)
    About This Section

    TryGeneCards Plus

    Subcellular locations from COMPARTMENTS: 

    CompartmentConfidence
    cytosol5
    mitochondrion3
    nucleus1

    Gene Ontology (GO): 3 cellular component terms:    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005739mitochondrion ----
    GO:0005829cytosol TAS12463163
    GO:0009986cell surface TAS12463163

    NRD1 for ontologies           About GeneDecksing


    (SuperPaths according to PathCards, Pathways according to R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to QIAGEN, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Apr 2014 via Entrez Gene).
    About This Section

    TryGeneCards Plus



        Custom Pathway & Disease-focused RT2 Profiler PCR Arrays for NRD1
    Interactions:

        GeneGlobe Interaction Network for NRD1

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    Selected Interacting proteins for NRD1 (O438471, 2, 3 ENSP000003468904) via UniProtKB, MINT, STRING, and/or I2D (see all 63)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    TP53P046371, 2EBI-2371631,EBI-366083 MINT-8415694 MINT-8415621 MINT-8415680 MINT-8415512 MINT-8415713 MINT-8415610
    BTRCQ9Y2973, ENSP000003592064I2D: score=2 STRING: ENSP00000359206
    CALCAP012583, ENSP000003317464I2D: score=1 STRING: ENSP00000331746
    MYCP011063, ENSP000003672074I2D: score=1 STRING: ENSP00000367207
    SLX4Q8IY923, ENSP000002940084I2D: score=1 STRING: ENSP00000294008
    About this table

    Gene Ontology (GO): Selected biological process terms (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006508proteolysis NAS9581555
    GO:0007528neuromuscular junction development TAS9479496
    GO:0008283cell proliferation TAS12463163
    GO:0016477cell migration TAS15544571
    GO:0051044positive regulation of membrane protein ectodomain proteolysis IDA18355445

    NRD1 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience, ApexBio, HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB)
    About This Section

    TryGeneCards Plus
    Browse Small Molecules at EMD Millipore
       Browse drugs & compounds from Enzo Life Sciences
      Browse compounds at ApexBio 

    Browse Tocris compounds for NRD1 (NRDC)

    2 Novoseek inferred chemical compound relationships for NRD1 gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    spermine 51.3 3 11478915 (1), 14759602 (1), 9521698 (1)
    arginine 42.1 9 11042131 (1), 8937991 (1), 7819328 (1), 12590613 (1) (see all 5)



    NRD1 for compounds           About GeneDecksing



    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN, SwitchGear Genomics,
    Tagged/untagged cDNA clones from OriGene, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, and/or QIAGEN )
    About This Section

    TryGeneCards Plus

    REFSEQ mRNAs for NRD1 gene (3 alternative transcripts): 
    NM_001101662.1  NM_001242361.1  NM_002525.2  

    Unigene Cluster for NRD1:

    Nardilysin (N-arginine dibasic convertase)
    Hs.584782  [show with all ESTs]
    Unigene Representative Sequence: NM_002525
    14 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000440943 ENST00000352171(uc001ctd.4 uc001ctf.2) ENST00000354831(uc009vzb.3 uc001ctc.4)
    ENST00000485608 ENST00000464385 ENST00000475310 ENST00000497358 ENST00000483007
    ENST00000473805 ENST00000475715 ENST00000491410 ENST00000468722 ENST00000539524(uc001cte.3 uc009vzc.1)
    ENST00000544028(uc010ong.1)

    miRNA
    Products:
         
    Block miRNA regulation of human, mouse, rat NRD1 using miScript Target Protectors
    Search for qRT-PCR Assays for microRNAs that regulate NRD1
    Browse SwitchGear 3'UTR luciferase reporter plasmids
    Inhib. RNA
    Products:
         
    OriGene RNAi products in human, mouse, rat for NRD1
    Predesigned siRNA for gene silencing in human, mouse, rat NRD1
    Clone
    Products:
         
    OriGene clones in human, mouse for NRD1 (see all 13)
    OriGene ORF clones in mouse, rat for NRD1
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector (see all 2): NRD1 (NM_002525)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for NRD1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NRD1
    Primer
    Products:
        
    OriGene qSTAR qPCR primer pairs in human, mouse for NRD1
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat NRD1
      QuantiTect SYBR Green Assays in human, mouse, rat NRD1
      QuantiFast Probe-based Assays in human, mouse, rat NRD1

    Additional mRNA sequence: 

    AK055516.1 AK299271.1 AK302616.1 AK311631.1 AK312318.1 AY049784.1 AY360265.1 BC008775.2 
    HM370401.1 U64898.1 X93207.1 X93209.1 

    Selected DOTS entries (see all 36):

    DT.100038998  DT.99966468  DT.449269  DT.100877939  DT.95170034  DT.101956137  DT.121419432  DT.413005 
    DT.121419346  DT.100877935  DT.40205024  DT.121419462  DT.429998  DT.449268  DT.99935860  DT.100877933 
    DT.100038999  DT.97854783  DT.121419446  DT.92451107  DT.95341545  DT.100877938  DT.101977395  DT.92451102 

    Selected AceView cDNA sequences (see all 576):

    AA782877 AI805897 BM474841 CA307385 BG389334 AU122072 AA485997 AJ709224 
    AI690742 BM743120 CA432225 BQ683003 CB306147 CB137386 AK090844 AA328748 
    BU166431 CD370057 CB851037 AA846301 CD722367 F01648 BG696558 BG388295 

    GeneLoc Exon Structure

    Selected Alternative Splicing Database (ASD) splice patterns (SP) for NRD1 (see all 16)    About this scheme

    ExUns: 1a · 1b · 1c · 1d · 1e ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11a · 11b ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18a · 18b ^ 19a ·
    SP1:                                                                                                                                                  -     -   
    SP2:                                                                          -                                                                       -     -   
    SP3:                                                                          -     -                                                                 -     -   
    SP4:                                                                                                                                                            
    SP5:                                                                                                                                                            

    ExUns: 19b · 19c ^ 20a · 20b · 20c ^ 21 ^ 22 ^ 23a · 23b · 23c ^ 24 ^ 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31a · 31b ^ 32a · 32b ^ 33 ^ 34 ^ 35 ^ 36a · 36b ^
    SP1:  -           -           -                                                           -                 -                                                   
    SP2:  -           -           -                                                           -                 -                                                   
    SP3:  -           -           -                                                           -                 -                                                   
    SP4:                                                                                                                                                            
    SP5:              -           -                                                                                                                                 

    ExUns: 37 ^ 38 ^ 39
    SP1:                  
    SP2:                  
    SP3:                  
    SP4:                  
    SP5:                  


    ECgene alternative splicing isoforms for NRD1

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MaxQB, plus additional links to SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from QIAGEN, Primers from OriGene, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    TryGeneCards Plus

    NRD1 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: TTGTTGGATA
    NRD1 Expression
    About this image

    NRD1 Protein expression data from MOPED1, PaxDb2 and MaxQB3    About this image

    NRD1 Protein Expression

    SOURCE GeneReport for Unigene cluster: Hs.584782

    UniProtKB/Swiss-Prot: NRDC_HUMAN, O43847
    Tissue specificity: Primarily in adult heart, skeletal muscle, and testis and at much lower levels in other
    tissues

        Custom PCR Arrays for NRD1
    Primer
    Products:
    OriGene qSTAR qPCR primer pairs in human, mouse for NRD1
    Pre-validated RT2 qPCR Primer Assay in human, mouse, rat NRD1
    QuantiTect SYBR Green Assays in human, mouse, rat NRD1
    QuantiFast Probe-based Assays in human, mouse, rat NRD1
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NRD1

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    TryGeneCards Plus

    This gene was present in the common ancestor of eukaryotes.

    Orthologs for NRD1 gene from Selected species (see all 17)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Nrd11 , 5 nardilysin, N-arginine dibasic convertase, NRD convertase more1, 5 90.59(n)1
    93.38(a)1
      4 (50.77 cM)5
    2305981  NM_146150.21  NP_666262.21 
     1090006555 
    chicken
    (Gallus gallus)
    Aves NRD11 nardilysin (N-arginine dibasic convertase) 75.63(n)
    79.51(a)
      424635  NM_001031284.1  NP_001026455.1 
    lizard
    (Anolis carolinensis)
    Reptilia --
    --
    Uncharacterized protein
    70(a)
    64(a)
    1 ↔ many
    1 ↔ many
    4(114203956-114244246)
    4(11840916-11901971)
    African clawed frog
    (Xenopus laevis)
    Amphibia BJ620409.12   -- 75.29(n)    BJ620409.1 
    zebrafish
    (Danio rerio)
    Actinopterygii wufk24c072 Transcribed sequence with moderate similarity to protein more 76.11(n)    BQ419772.1 
    fruit fly
    (Drosophila melanogaster)
    Insecta CG20253 nardilysin 36(a)
    (best of 2)
      10F2   --
    baker's yeast
    (Saccharomyces cerevisiae)
    Saccharomycetes STE236
    Metalloprotease involved, with homolog Axl1p, in N...
    27(a)
    1 → many
    XII(899577-902660) YLR389C
    thale cress
    (Arabidopsis thaliana)
    eudicotyledons AT1G069001 AT1G06900 47.34(n)
    35.76(a)
      837200  NM_100565.4  NP_172173.2 
    rice
    (Oryza sativa)
    Liliopsida Os03g03363001 Os03g0336300 47.87(n)
    36.56(a)
      4332762  NM_001056575.1  NP_001050040.1 


    ENSEMBL Gene Tree for NRD1 (if available)
    TreeFam Gene Tree for NRD1 (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section

    TryGeneCards Plus
    Paralogs for NRD1 gene
    IDE2  
    1 SIMAP similar gene for NRD1 using alignment to 7 protein entries:     NRDC_HUMAN (see all proteins):
    IDE

    NRD1 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD), the Human Cytochrome P450 Allele Nomenclature Database, and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers, Cancer Mutation PCR Arrays and Assays, and Copy Number PCR Arrays from QIAGEN)
    About This Section

    TryGeneCards Plus

    Selected SNPs for NRD1 (see all 1973)    About this table    
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 1 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs113649791,2
    C--50383586(+) TTGGC-/TTTTTT 3 -- int1 trp32Minor allele frequency- T:0.00NA CSA 4
    rs1495922111,2
    C--50385799(+) GTCTC-/AAAAAAA 3 -- int10--------
    rs357235191,2
    C--50422784(+) CATCA-/TCTTCTTC 3 D cds10--------
    rs726631471,2
    C--50422786(+) TCATCA/TTCTTC 6 E D mis10--------
    rs360040791,2
    C--50458171(+) CTAAG-/AAGGAC 3 -- int11Minor allele frequency- A:0.00NA 2
    rs360804561,2
    C--50462626(+) ATTGC-/TTTGAG 3 -- us2k12Minor allele frequency- T:0.00NA CSA 4
    rs1139128281,2
    C--52255888(+) AGACAAA/-GAGTC 3 -- int11Minor allele frequency- -:0.50CSA 2
    rs107169801,2
    C,F--52262264(+) TTTTTT/-AGACG 3 -- int1 trp33Minor allele frequency- -:0.50NA CSA 6
    rs75275131,2
    C,F,A--52270293(+) TCAGAC/TACATT 3 -- int13Minor allele frequency- T:0.50NA 8
    rs75275221,2
    C,F--52270341(+) TATCTC/GCTATG 3 -- int13Minor allele frequency- G:0.38NA 8

    HapMap Linkage Disequilibrium report for NRD1 (52254863 - 52344609 bp)

    Structural Variations
         Database of Genomic Variants (DGV) 6 variations for NRD1:    About this table    
    Variant IDTypeSubtypePubMed ID
    esv1684865CNV Insertion17803354
    nsv512738CNV Insertion21212237
    esv2551965CNV Insertion19546169
    esv1546529CNV Insertion17803354
    nsv519495CNV Loss19592680
    nsv829837CNV Loss17160897

    Site Specific Mutation Identification with PCR Assays
    SeqTarget long-range PCR primers for resequencing NRD1
    DNA2.0 Custom Variant and Variant Library Synthesis for NRD1

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    TryGeneCards Plus
    OMIM gene information: 602651    OMIM disorders: --

    9 diseases for NRD1:    
    About MalaCards
    differentiating neuroblastoma    neuroblastoma    alcohol dependence    down syndrome
    alzheimer's disease    hiv-1    prostatitis    neuronitis
    malaria


    NRD1 for disorders           About GeneDecksing


    Congresses - knowledge worth sharing:
    Alzheimer's & Parkinson's Diseases Congress (ADPD) 18 - 22 March 2015

    1 Novoseek inferred disease relationship for NRD1 gene    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    tumors 0 2 16923819 (2)

    Genetic Association Database (GAD): NRD1
    Human Genome Epidemiology (HuGE) Navigator: NRD1 (1 document)

    Export disorders for NRD1 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    TryGeneCards Plus

    PubMed articles for NRD1 gene, integrated from 10 sources (see all 60):
    (articles sorted by number of sources associating them with NRD1)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family. (PubMed id 9581555)1, 2, 3, 9 Hospital V.... Cohen P. (Biochem. J. 1997)
    2. Human NRD convertase: a highly conserved metalloendopeptidase expressed at specific sites during development and in adult tissues. (PubMed id 9479496)1, 2, 3, 9 Fumagalli P.... Taramelli R. (Genomics 1998)
    3. Gene expression of the dibasic-pair cleaving enzyme NRD convertase (N-arginine dibasic convertase) is differentially regulated in the GH3 pituitary and Mat-Lu prostate cell lines. (PubMed id 11042131)1, 2, 9 Winter A.G. and Pierotti A.R. (Biochem. J. 2000)
    4. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PubMed id 20877624)1, 4 Hendrickson S.L....O'Brien S.J. (PLoS ONE 2010)
    5. The DNA sequence and biological annotation of human chromosome 1. (PubMed id 16710414)1, 2 Gregory S.G.... Bentley D.R. (Nature 2006)
    6. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S.... Malek J. (Genome Res. 2004)
    7. Nardilysin enhances ectodomain shedding of heparin-binding epidermal growth factor-like growth factor through activation of tumor necrosis factor-alpha-converting enzyme. (PubMed id 16923819)1, 9 Nishi E....Kita T. (J. Biol. Chem. 2006)
    8. The metalloendopeptidase nardilysin (NRDc) is potently inhibited by heparin-binding epidermal growth factor-like growth factor (HB-EGF). (PubMed id 12095415)1, 9 Hospital V....Prat A. (Biochem. J. 2002)
    9. N-arginine dibasic convertase is a specific receptor for heparin-binding EGF-like growth factor that mediates cell migration. (PubMed id 11432822)1, 9 Nishi E....Klagsbrun M. (EMBO J. 2001)
    10. Ectodomain shedding of TNF-alpha is enhanced by nardilysin via activation of ADAM proteases. (PubMed id 18355445)1, 9 Hiraoka Y....Nishi E. (Biochem. Biophys. Res. Commun. 2008)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section

    TryGeneCards Plus
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section

    TryGeneCards Plus
    Entrez Gene: 4898 HGNC: 7995 AceView: NRD1 Ensembl:ENSG00000078618 euGenes: HUgn4898
    ECgene: NRD1 H-InvDB: NRD1

    (According to HUGE)
    About This Section

    TryGeneCards Plus
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL, and/or others, e.g. Wikipedia and GeneReviews, via UniProtKB/Swiss-Prot)
    About This Section

    TryGeneCards Plus
    NameDescription
    PharmGKB entry for NRD1 Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for NRD1 Genetics and Cytogenetics in Oncology and Haematology

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section

    TryGeneCards Plus
    Patent Information for NRD1 gene:
    Search GeneIP for patents involving NRD1

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0. Clones from OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript, and ESI BIO, PCR Arrays from QIAGEN, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, Enzo Life Sciences, and/or ApexBio, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

    TryGeneCards Plus

     
     EMD Millipore genomic analysis products

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Enzyme Activity Assays/Reagents  
     Browse ELISpot/FluoroSpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Luminex Assays  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Recombinant/Natural Proteins   Browse Stem Cell Products  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     Browse OriGene Antibodies   OriGene RNAi products in human, mouse, rat for NRD1  
     Browse OriGene qPCR primer pairs and template standards   OriGene Protein Over-expression Lysate for NRD1  
     OriGene MassSpec something-or-other for NRD1   OriGene clones in human, mouse for NRD1  
     OriGene qSTAR qPCR primer pairs in human, mouse for NRD1   OriGene Purified Protein for NRD1  
     OriGene ORF clones in mouse, rat for NRD1   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for NRD1   OriGene Custom Protein Services for NRD1  

     
     
     Block miRNA regulation of human, mouse, rat NRD1 using miScript Target Protectors SeqTarget long-range PCR primers for resequencing NRD1
     DNA Methylation CpG Assay Predesigned for Pyrosequencing in human, mouse, rat NRD1 Predesigned siRNA for gene silencing in human, mouse, rat NRD1
     QuantiFast Probe-based Assays in human, mouse, rat NRD1 QuantiTect SYBR Green Assays in human, mouse, rat NRD1
     Custom PCR Arrays for NRD1 Search Chromatin IP Primers for NRD1
     Pre-validated RT2 qPCR Primer Assay in human, mouse, rat NRD1  GeneGlobe Interaction Network for NRD1
     Regulatory tfbs in NRD1 promoter
     GenScript Custom Purified and Recombinant Proteins Services for NRD1 GenScript cDNA clones with any tag delivered in your preferred vector for NRD1
     GenScript Custom Assay Services for NRD1 GenScript Custom overexpressing Cell Line Services for NRD1
     CloneReady with Over 120,000 Genes  Gene Synthesis: Any Gene in Any Vector
     Vector-based siRNA and miRNA, Ready for Transfection Gene Mutant Library, Variants up to 10^11
     Plasmid Preparation Custom Peptide Services
     Search for Antibodies & Assays

     Search Tocris compounds for NRD1 (NRDC)
     Browse Sino Biological Proteins
     Browse Sino Biological Cell Lysates
     Browse Sino Biological cDNA Clones
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies

     Novus Tissue Slides
     NRD1 antibodies
     NRD1 proteins
     NRD1 lysates
     Antibodies for NRD1
     See all of Abcam's Antibodies, Kits and Proteins for NRD1
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins
     Proteins for NRD1
     Antibodies for NRD1
     ELISAs for NRD1
     CLIAs for NRD1



     Browse ESI BIO Cell Lines and PureStem Progenitors for NRD1
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NRD1
     Browse SwitchGear 3'UTR luciferase reporter plasmids for NRD1
     SwitchGear Promoter luciferase reporter plasmids for NRD1
     ThermoFisher Antibodies for NRD1
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NRD1
     inGenious Targeting Laboratory: Let us create your new Knockout/Knockin mouse model for NRD1
     inGenious Targeting Laboratory: Contact us about creating complex and humanized mouse models for NRD1
     LSBio Antibodies in human, mouse, rat for NRD1
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
     Browse compounds at ApexBio
           
    GeneCards Homepage - Last full update: 7 May 2014 - Incrementals: 9 May 2014 , 2 Jun 2014 , 26 Jun 2014 , 30 Jun 2014

    View Random Gene

    Category
    (GIFtS: )
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      NRD1 gene at Home site.
    Version: 3.12.142 28 July 2014
    hostname: 356980-web2.xennexinc.com index build: 126 solr: 1.4