Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

NRD1 Gene

protein-coding   GIFtS: 56
GCID: GC01M052254

nardilysin (N-arginine dibasic convertase)
 Explore 8 diseases affiliated with
NRD1 via
MalaCards
our new
 Human Malady Compendium 
Biological research products
for NRD1    

Aliases
for NRD1 gene

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section
Aliases
Nardilysin (N-Arginine Dibasic Convertase)1 2     EC 3.4.24.613 8
HNRD11     Nardilysin1
HNRD21     N-Arginine Dibasic Convertase3
NRD-C2 3     EC 3.4.248
NRD Convertase2 3     

External Ids:    HGNC: 79951   Entrez Gene: 48982   Ensembl: ENSG000000786187   OMIM: 6026515   UniProtKB: O438473   

Export aliases for NRD1 gene to outside databases

Previous GC identifers: GC01M051848 GC01M051143 GC01M051613 GC01M051624 GC01M051966 GC01M052028 GC01M050371


Summaries
for NRD1 gene

(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section
Entrez Gene summary for NRD1:
This gene encodes a zinc-dependent endopeptidase that cleaves peptide substrates at the N-terminus of arginine residues
in dibasic moieties and is a member of the peptidase M16 family. This protein interacts with heparin-binding EGF-like
growth factor and plays a role in cell migration and proliferation. Multiple transcript variants encoding different
isoforms have been found for this gene. (provided by RefSeq, May 2011)

UniProtKB/Swiss-Prot: NRDC_HUMAN, O43847
Function: Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs

Gene Wiki entry for NRD1


Genomic Views
for NRD1 gene

(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000001.10  NC_018912.1  NT_032977.9  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the NRD1 gene promoter:
         CBF-B   CBF-A   NF-YA   FOXO3a   CP1C   CP1A   NF-Y   CBF-C   CBF(2)   FOXO3b   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmid: NRD1 promoter sequence
   Search SABiosciences Chromatin IP Primers for NRD1

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat NRD1


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 1p32.2-p32.1   Ensembl cytogenetic band:  1p32.3   HGNC cytogenetic band: 1p32.2-p32.1

NRD1 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
NRD1 gene location

GeneLoc information about chromosome 1         GeneLoc Exon Structure

GeneLoc location for GC01M052254:  view genomic region     (about GC identifiers)

Start:
 52,254,863 bp from pter      End:
 52,344,609 bp from pter
Size:
 89,747 bases      Orientation:
 minus strand

Proteins
for NRD1 gene

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section
UniProtKB/Swiss-Prot: NRDC_HUMAN, O43847 (See protein sequence)
Recommended Name: Nardilysin precursor  
Size: 1150 amino acids; 131572 Da
Cofactor: Binds 1 zinc ion per subunit (By similarity)
Secondary accessions: A6NI41 O15241 O15242 Q5VUL0 Q96HB2 Q9NU57
Alternative splicing: 2 isoforms:  O43847-1   O43847-2   

Explore the universe of human proteins at neXtProt for NRD1: NX_O43847

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_O43847

    • 3 DME Specific Peptides for NRD1 (O43847)
     GHEGKGSILS  SAANVVLFDIF  NILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK 

    NRD1 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins (3 alternative transcripts): 
    NP_001095132.1  NP_001229290.1  NP_002516.2  

    ENSEMBL proteins: 
     ENSP00000398464   ENSP00000262679   ENSP00000346890   ENSP00000444416   ENSP00000442262  

    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    OriGene Purified Protein: NRD1
    OriGene Protein Over-expression Lysate: NRD1
    OriGene Custom Protein Services for NRD1 
    GenScript Custom Purified and Recombinant Proteins Services for NRD1
    Novus Biologicals NRD1 Protein
    Novus Biologicals NRD1 Lysate
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for NRD1

    Gene Ontology (GO): 3 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005739mitochondrion ----
    GO:0005829cytosol TAS12463163
    GO:0009986cell surface TAS12463163


    NRD1 for ontologies           About GeneDecksing



    NRD1 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for NRD1 
    GenScript Custom Superior Antibodies Services for NRD1
    Novus Biologicals NRD1 Antibodies
    Search for Antibodies for NRD1 at Abcam  
    Uscn Antibodies for NRD1
    Search ThermoFisher Antibodies for NRD1

    Assay Products for NRD1: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for NRD1
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for NRD1

    Protein Domains /
    Families
    for NRD1 gene

    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section
    NRD1 for domains           About GeneDecksing

    5 InterPro domains/families:
     IPR001431 Pept_M16_Zn_BS
     IPR007863 Peptidase_M16_C
     IPR011765 Pept_M16_N
     IPR011249 Metalloenz_LuxS/M16
     IPR011237 Pept_M16_dom

    Graphical View of Domain Structure for InterPro Entry O43847

    ProtoNet protein and cluster: O43847

    1 Blocks protein family: IPB001431 Insulinase-like peptidase

    UniProtKB/Swiss-Prot: NRDC_HUMAN, O43847
    Similarity: Belongs to the peptidase M16 family


    Function
    for NRD1 gene

    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section
    Function Summary:

         UniProtKB/Swiss-Prot: NRDC_HUMAN, O43847
    Function: Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs
    Catalytic activity: Hydrolysis of polypeptides, preferably at -Xaa- -Arg-Lys-, and less commonly at -Arg- -Arg-Xaa-, in
    which Xaa is not Arg or Lys

         Genatlas biochemistry entry for NRD1:
    nardilysin,N-arginine dibasic convertase,expressed in testis and in embryonic nervous system,involved in development

    Enzyme Numbers (IUBMB): EC 3.4.24.611 2 EC 3.4.242

    miRNA
    Products:            		 OriGene 3'-UTR Clone (see all 2): NRD1
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat NRD1
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate NRD1
    Browse SwitchGear 3'UTR luciferase reporter plasmids
    Inhib. RNA
    Products:            		Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for NRD1 (see all 7)
    OriGene shRNA RFP: NRD1
    OriGene siRNA: NRD1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat NRD1

    Gene Editing
    Products:    		DNA2.0 Custom Protein Engineering Service for NRD1

    Clone
    Products:             		Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for NRD1 (see all 4)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for NRD1 (see all 3)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): NRD1 (NM_002525)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for NRD1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NRD1 

    Cell Line
    Products:             		GenScript Custom overexpressing Cell Line Services for NRD1
    Search LifeMap BioReagents cell lines for NRD1

    In Situ Assay
    Products:       
         		Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NRD1

    Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004222metalloendopeptidase activity NAS9581555
    GO:0005515protein binding IPI18355445
    GO:0008270zinc ion binding IEA--
    GO:0048408epidermal growth factor binding TAS12463163


    NRD1 for ontologies           About GeneDecksing


    2 GenomeRNAi human phenotypes for NRD1:
     Increased Salmonella enterica   Synthetic lethal with Ras 

    Animal Models:
         4 MGI mutant phenotypes (inferred from 1 allele) (MGI details for Nrd1):
     behavior/neurological  growth/size  mortality/aging  nervous system 

    NRD1 for phenotypes           About GeneDecksing


    Pathways & Interactions
    for NRD1 gene

    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section



    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for NRD1

    STRING Interaction Network Preview (showing 5 interactants - click image to see 25)

    5/58 Interacting proteins for NRD1 (O438472, 3 ENSP000003468904) via UniProtKB, MINT, STRING, and/or I2D (see all 58)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    TP53P046372MINT-8415694 MINT-8415621 MINT-8415680 MINT-8415512 MINT-8415713 MINT-8415610
    HBEGFQ990753, ENSP000002309904I2D: score=3 STRING: ENSP00000230990
    CALCAP012583, ENSP000003317464I2D: score=1 STRING: ENSP00000331746
    MYCP011063, ENSP000003672074I2D: score=1 STRING: ENSP00000367207
    FBXW11Q9UKB13, ENSP000002650944I2D: score=2 STRING: ENSP00000265094
    About this table

    Gene Ontology (GO): 5/6 biological process terms (GO ID links to tree view) (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006508proteolysis NAS9581555
    GO:0007528neuromuscular junction development TAS9479496
    GO:0008283cell proliferation TAS12463163
    GO:0016477cell migration TAS15544571
    GO:0051044positive regulation of membrane protein ectodomain proteolysis IDA18355445


    NRD1 for ontologies           About GeneDecksing



    Drugs & Compounds
    for NRD1 gene

    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    NRD1 for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for NRD1
    2 Novoseek chemical compound relationships for NRD1 gene    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    spermine 51.3 3 11478915 (1), 14759602 (1), 9521698 (1)
    arginine 42.1 9 11042131 (1), 8937991 (1), 7819328 (1), 12590613 (1) (see all 5)

    Search CenterWatch for drugs/clinical trials and news about NRD1 / NRDC 

    Transcripts
    for NRD1 gene

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section
    REFSEQ mRNAs for NRD1 gene (3 alternative transcripts): 
    NM_001101662.1  NM_001242361.1  NM_002525.2  

    Unigene Cluster for NRD1:

    Nardilysin (N-arginine dibasic convertase)
    Hs.584782  [show with all ESTs]
    Unigene Representative Sequence: NM_002525
    15 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000440943 ENST00000352171(uc001ctd.4 uc001ctf.2) ENST00000354831(uc009vzb.3 uc001ctc.4)
    ENST00000490160 ENST00000485608 ENST00000464385 ENST00000475310 ENST00000497358
    ENST00000483007 ENST00000473805 ENST00000475715 ENST00000491410 ENST00000468722
    ENST00000539524(uc001cte.3 uc009vzc.1) ENST00000544028(uc010ong.1)


    miRNA
    Products:             		 OriGene 3'-UTR Clone (see all 2): NRD1
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat NRD1
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate NRD1
    Browse SwitchGear 3'UTR luciferase reporter plasmids
    Inhib. RNA
    Products:             		Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for NRD1 (see all 7)
    OriGene shRNA RFP: NRD1
    OriGene siRNA: NRD1
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat NRD1
    Clone
    Products:             		 OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for NRD1 (see all 4)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for NRD1 (see all 3)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector (see all 2): NRD1 (NM_002525)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for NRD1
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NRD1 
    Primer
    Products:            		 OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for NRD1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat NRD1
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat NRD1
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat NRD1

    Additional cDNA sequence: 

    AK055516.1 AK299271.1 AK302616.1 AK311631.1 AK312318.1 AY049784.1 AY360265.1 BC008775.2 
    HM370401.1 U64898.1 X93207.1 X93209.1 

    24/36 DOTS entries (see all 36):

    DT.100038998  DT.99966468  DT.449269  DT.100877939  DT.95170034  DT.101956137  DT.121419432  DT.413005 
    DT.121419346  DT.100877935  DT.40205024  DT.121419462  DT.429998  DT.449268  DT.99935860  DT.100877933 
    DT.100038999  DT.97854783  DT.121419446  DT.92451107  DT.95341545  DT.100877938  DT.101977395  DT.92451102 

    24/576 AceView cDNA sequences (see all 576):

    BM743120 AA782877 BG388295 BQ683003 BM787406 F34896 CB306147 BG696558 
    BG389334 AW015896 BF526476 BE221866 AU133382 BM474841 CD370057 AW817631 
    AJ706897 BQ677092 CD722367 BM709476 AA694089 BQ922661 T10855 AU154505 

    GeneLoc Exon Structure

    5/16 Alternative Splicing Database (ASD) splice patterns (SP) for NRD1 (see all 16)    About this scheme

    ExUns: 1a · 1b · 1c · 1d · 1e ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11a · 11b ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18a · 18b ^ 19a ·
    SP1:                                                                                                                                                  -     -   
    SP2:                                                                          -                                                                       -     -   
    SP3:                                                                          -     -                                                                 -     -   
    SP4:                                                                                                                                                            
    SP5:                                                                                                                                                            

    ExUns: 19b · 19c ^ 20a · 20b · 20c ^ 21 ^ 22 ^ 23a · 23b · 23c ^ 24 ^ 25 ^ 26 ^ 27 ^ 28 ^ 29 ^ 30 ^ 31a · 31b ^ 32a · 32b ^ 33 ^ 34 ^ 35 ^ 36a · 36b ^
    SP1:  -           -           -                                                           -                 -                                                   
    SP2:  -           -           -                                                           -                 -                                                   
    SP3:  -           -           -                                                           -                 -                                                   
    SP4:                                                                                                                                                            
    SP5:              -           -                                                                                                                                 

    ExUns: 37 ^ 38 ^ 39
    SP1:                  
    SP2:                  
    SP3:                  
    SP4:                  
    SP5:                  


    ECgene alternative splicing isoforms for NRD1

    Expression
    for NRD1 gene

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    NRD1 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: TTGTTGGATA

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)
    About this image
    See NRD1 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for NRD1

    SOURCE GeneReport for Unigene cluster: Hs.584782

    UniProtKB/Swiss-Prot: NRDC_HUMAN, O43847
    Tissue specificity: Primarily in adult heart, skeletal muscle, and testis and at much lower levels in other tissues

        SABiosciences Custom PCR Arrays for NRD1
    Primer
    Products:    		 OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for NRD1
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat NRD1
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat NRD1
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat NRD1
    In Situ
    Assay Products:     
         		Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NRD1

    Orthologs
    for NRD1 gene

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section
    This gene was present in the last universal common ancestor (LUCA).

    Orthologs for NRD1 gene from 8/25 species (see all 25)    About this table
    Organism Taxonomic
    classification    		 Gene Description Human
    Similarity    		 Orthology
    Type    		 Details
    chicken
    (Gallus gallus)    		 Aves NRD11 nardilysin (N-arginine dibasic convertase) 75.06(n)
    78.26(a)    		   424635  NM_001031284.1  NP_001026455.1 
    lizard
    (Anolis carolinensis)    		 Reptilia NRD16
    --
    		 --
    		 69(a)
    63(a)
    		 1 ↔ many
    1 ↔ many
    		 4(114203956-114244106)
    4(11840916-11901862)
    African clawed frog
    (Xenopus laevis)    		 Amphibia BJ620409.12   -- 75.29(n)    BJ620409.1 
    zebrafish
    (Danio rerio)    		 Actinopterygii wufk24c072 Transcribed sequence with moderate similarity to protein more 76.11(n)    BQ419772.1 
    fruit fly
    (Drosophila melanogaster)    		 Insecta CG20251 , 3 nardilysin3
    CG20251    		 36(a)
    (best of 2)3
    46.6(n)1
    36.78(a)1    		   10F23
    321431  NM_132529.21  NP_572757.21 
    thale cress
    (Arabidopsis thaliana)    		 eudicotyledons AT1G069001 putative N-arginine dibasic convertase 48.33(n)
    36.84(a)    		   837200  NM_100565.4  NP_172173.2 
    rice
    (Oryza sativa)    		 Liliopsida Os03g03363001 hypothetical protein 47.52(n)
    35.82(a)    		   4332762  NM_001056575.1  NP_001050040.1 
    E. coli
    (Escherichia coli)    		 Gamma proteobacteria ptrA6
    		 protease III
    		 23(a)
    		 1 → many
    		 Chromosome(2954018-2956906)


    ENSEMBL Gene Tree for NRD1 (if available)
    TreeFam Gene Tree for NRD1 (if available) 

    Paralogs
    for NRD1 gene

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for NRD1 gene
    IDE2  
    1 SIMAP similar gene for NRD1 using alignment to 7 protein entries:     NRDC_HUMAN (see all proteins):
    IDE

    NRD1 for paralogs           About GeneDecksing



    Genomic Variants
    for NRD1 gene

    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/1601 NCBI SNPs in NRD1 are shown (see all 1601)     About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance    		Chr 1 posSequence#AA
    Chg    		TypeMore#Allele
    freq    		PopTotal
    sample    		More
    ----------
    rs787654461,2
    		--50371247(+) GTTACG/ATAAGG 3 -- ds50011Minor allele frequency- A:0.01NA 120
    rs1131558621,2
    		--50372061(+) AGCATC/TTGAAG 3 -- int11Minor allele frequency- T:0.50CSA 2
    rs753411041,2
    		--50372209(+) AGCTAA/GATACC 3 -- int11Minor allele frequency- G:0.01WA 118
    rs791198291,2
    		C,--50372274(+) AGCTGC/TATACC 3 -- int12Minor allele frequency- T:0.06CSA WA 120
    rs754305871,2
    		C,F,--50372281(+) TACCAC/TGGCTT 3 -- int11Minor allele frequency- T:0.02WA 118
    rs120441511,2
    		C,H,--50372377(+) CAATGA/GTGTCC 3 -- int16Minor allele frequency- G:0.00NS EA NA 506
    rs781980381,2
    		C,F,--50372580(+) TCTTGT/CAGACC 3 -- int11Minor allele frequency- C:0.03NA 120
    rs120238781,2
    		C,F,H,--50372712(+) GTGAGC/TGAGTA 3 -- int113Minor allele frequency- T:0.04NS EA NA 1718
    rs412932471,2
    		F,--50372766(+) CTGGTG/ATGCAC 3 -- int11Minor allele frequency- A:0.09NA 120
    rs1113904221,2
    		--50373037(+) CAGCCC/TGGCTT 3 -- int11Minor allele frequency- T:0.50CSA 2

    HapMap Linkage Disequilibrium report for NRD1 (52254863 - 52344609 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
    Database of Genomic Variants (DGV): 9 variations for NRD1
         5 CNVs: 84241 84240 84236 4223 74482
         4 Indels: 97354 74479 84232 84233

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing NRD1
    DNA2.0 Custom Variant and Variant Library Synthesis for NRD1

    Disorders / Diseases
    for NRD1 gene

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section
    NRD1 for disorders           About GeneDecksing

    OMIM gene information: 602651    OMIM disorders: --

    8 diseases for NRD1:    About MalaCards
    differentiating neuroblastoma    down syndrome    alzheimer's disease    neuroblastoma
    prostatitis    neuronitis    alcohol dependence    alcoholism

    1 Novoseek disease relationship for NRD1 gene    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    tumors 0 2 16923819 (2)

    Human Genome Epidemiology (HuGE) Navigator: NRD1 (1 document)

    Export disorders for NRD1 gene to outside databases

    Publications
    for NRD1 gene

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for NRD1 gene, integrated from 9 sources (see all 57):
    (articles sorted by number of sources associating them with NRD1)    		    Utopia: connect your pdf to the dynamic
    world of online information

    1. Human and rat testis express two mRNA species encoding variants of NRD convertase, a metalloendopeptidase of the insulinase family. (PubMed id 9581555)1, 2, 3, 9 Hospital V.... Cohen P. (1997)
    2. Human NRD convertase: a highly conserved metalloendopeptidase expressed at specific sites during development and in adult tissues. (PubMed id 9479496)1, 2, 3, 9 Fumagalli P....Taramelli R. (1998)
    3. Gene expression of the dibasic-pair cleaving enzyme NRD convertase (N-arginine dibasic convertase) is differentially regulated in the GH3 pituitary and Mat-Lu prostate cell lines. (PubMed id 11042131)1, 2, 9 Winter A.G. and Pierotti A.R. (2000)
    4. The DNA sequence and biological annotation of human chromosome 1. (PubMed id 16710414)1, 2 Gregory S.G.... Bentley D.R. (2006)
    5. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    6. Nardilysin enhances ectodomain shedding of heparin-binding epidermal growth factor-like growth factor through activation of tumor necrosis factor-alpha-converting enzyme. (PubMed id 16923819)1, 9 Nishi E....Kita T. (2006)
    7. The metalloendopeptidase nardilysin (NRDc) is potently inhibited by heparin-binding epidermal growth factor-like growth factor (HB-EGF). (PubMed id 12095415)1, 9 Hospital V....Prat A. (2002)
    8. N-arginine dibasic convertase is a specific receptor for heparin-binding EGF-like growth factor that mediates cell migration. (PubMed id 11432822)1, 9 Nishi E....Klagsbrun M. (2001)
    9. Ectodomain shedding of TNF-alpha is enhanced by nardilysin via activation of ADAM proteases. (PubMed id 18355445)1, 9 Hiraoka Y....Nishi E. (2008)
    10. Nardilysin cleaves peptides at monobasic sites. (PubMed id 12590613)1, 9 Chow K.M....Hersh L.B. (2003)

    External Searches for NRD1 gene

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  
      Query String
    		PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    Genome Databases showing NRD1 gene

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 4898 HGNC: 7995 AceView: NRD1 Ensembl:ENSG00000078618 euGenes: HUgn4898
    ECgene: NRD1 H-InvDB: NRD1

    Other Databases showing NRD1 gene

    (According to HUGE)
    About This Section
    		   --

    Specialized Databases showing NRD1 gene

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for NRD1 Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for NRD1 Genetics and Cytogenetics in Oncology and Haematology

    Intellectual Property
    for NRD1 gene

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    		Patent Information for NRD1 gene:
    Search GeneIP for patents involving NRD1

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    Products
    for NRD1 gene

    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     Browse OriGene Antibodies   OriGene shRNA RFP for NRD1  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for NRD1   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for NRD1  
     OriGene Protein Over-expression Lysate for NRD1   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for NRD1   OriGene 3'-UTR Clone for NRD1  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for NRD1   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for NRD1  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     OriGene Purified Protein for NRD1   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for NRD1   OriGene Custom Protein Services for NRD1  
     OriGene Custom Immunoassay Development  

         		 
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat NRD1
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing NRD1
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat NRD1
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat NRD1
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat NRD1
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat NRD1
     GenScript Custom Purified and Recombinant Proteins Services for NRD1 GenScript cDNA clones with any tag delivered in your preferred vector for NRD1
     GenScript Custom Assay Services for NRD1 GenScript Custom Superior Antibodies Services for NRD1
     GenScript Custom overexpressing Cell Line Services for NRD1 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in NRD1 promoter
     Search Chromatin IP Primers for NRD1
     RT2 qPCR Primer Assay in human, mouse, rat NRD1
     GNC Network for NRD1
     SABiosciences Custom PCR Arrays for NRD1
     Search Tocris compounds for NRD1
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     NRD1 antibodies
     NRD1 proteins
     NRD1 lysates
     Search for Antibodies for NRD1 at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for NRD1
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     NRD1 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for NRD1
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NRD1
     Browse SwitchGear 3'UTR luciferase reporter plasmids for NRD1
     SwitchGear Promoter luciferase reporter plasmids for NRD1
     Search ThermoFisher Antibodies for NRD1
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NRD1
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 

    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Copyright © 1996-2013 , Weizmann Institute of Science. All Rights Reserved.
    Hot genes      Disease genes      NRD1 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4