Free for academic non-profit institutions. Other users need a Commercial license

Aliases for NLN Gene

Aliases for NLN Gene

  • Neurolysin 2 3 5
  • Neurotensin Endopeptidase 2 3 4
  • Neurolysin (Metallopeptidase M3 Family) 2 3
  • Mitochondrial Oligopeptidase M 3 4
  • Angiotensin Binding Protein 2 3
  • Microsomal Endopeptidase 3 4
  • EC 3.4.24.16 4 58
  • AGTBP 3 4
  • MEP 3 4
  • Angiotensin-Binding Protein 4
  • Neurolysin, Mitochondrial 3
  • Endopeptidase 24.16 3
  • EC 3.4.24 58
  • KIAA1226 4
  • EP24.16 3
  • MOP 3

External Ids for NLN Gene

Previous HGNC Symbols for NLN Gene

  • AGTBP

Previous GeneCards Identifiers for NLN Gene

  • GC05P065169
  • GC05P066556
  • GC05P064988
  • GC05P065033
  • GC05P065053
  • GC05P065018
  • GC05P061976

Summaries for NLN Gene

Entrez Gene Summary for NLN Gene

  • This gene encodes a member of the metallopeptidase M3 protein family that cleaves neurotensin at the Pro10-Tyr11 bond, leading to the formation of neurotensin(1-10) and neurotensin(11-13). The encoded protein is likely involved in the termination of the neurotensinergic signal in the central nervous system and in the gastrointestinal tract.[provided by RefSeq, Jun 2010]

GeneCards Summary for NLN Gene

NLN (Neurolysin) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors and Signaling by GPCR. GO annotations related to this gene include metalloendopeptidase activity and peptide binding. An important paralog of this gene is THOP1.

UniProtKB/Swiss-Prot for NLN Gene

  • Hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A.

Gene Wiki entry for NLN Gene

Additional gene information for NLN Gene

No data available for CIViC summary , Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for NLN Gene

Genomics for NLN Gene

Regulatory Elements for NLN Gene

Enhancers for NLN Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH05H066142 1.4 ENCODE dbSUPER 10.3 +422.5 422455 4 HDGF PKNOX1 FOXA2 ARNT ARID4B SIN3A FEZF1 DMAP1 ZNF2 YY1 PPWD1 SREK1 TRAPPC13 TRIM23 NLN SGTB ENSG00000253744
GH05H065809 1.3 Ensembl ENCODE dbSUPER 10.2 +89.8 89843 4 FEZF1 RAD21 RFX5 TCF12 GATA2 RCOR1 FOS CEBPB TSHZ1 ZNF843 SGTB NLN ENSG00000252904 TRAPPC13 CENPK GC05P065768 ENSG00000269961
GH05H065742 1.1 Ensembl ENCODE 12 +20.6 20591 1 CTCF ATF1 ZBTB21 INSM2 BATF ZNF2 RAD21 RFX5 FOSL1 ZNF366 NLN PPWD1 LOC100419549 GC05P065768
GH05H065720 1 ENCODE 12.4 -0.1 -50 2 PKNOX1 ZNF133 ARID4B SIN3A DMAP1 GLI4 ZNF2 YY1 ZNF121 GLIS2 PPWD1 NLN CENPK ENSG00000250081 TRIM23
GH05H065623 1.1 ENCODE 10.3 -97.4 -97383 3 HDGF PKNOX1 FOXA2 ARNT ARID4B SIN3A DMAP1 YY1 ZNF766 ZNF143 PPWD1 CENPK SREK1 RNU6-540P NLN SGTB TRAPPC13 TRIM23 ENSG00000253251
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around NLN on UCSC Golden Path with GeneCards custom track

Promoters for NLN Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000181600 104 2601 PKNOX1 ZFP64 ZNF133 ARID4B SIN3A DMAP1 GLI4 ZNF2 YY1 ZNF121

Genomic Location for NLN Gene

Chromosome:
5
Start:
65,722,196 bp from pter
End:
65,871,725 bp from pter
Size:
149,530 bases
Orientation:
Plus strand

Genomic View for NLN Gene

Genes around NLN on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
NLN Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for NLN Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for NLN Gene

Proteins for NLN Gene

  • Protein details for NLN Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q9BYT8-NEUL_HUMAN
    Recommended name:
    Neurolysin, mitochondrial
    Protein Accession:
    Q9BYT8
    Secondary Accessions:
    • Q9ULJ4

    Protein attributes for NLN Gene

    Size:
    704 amino acids
    Molecular mass:
    80652 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    No Data Available

neXtProt entry for NLN Gene

Selected DME Specific Peptides for NLN Gene

Q9BYT8:
  • LDFPQHVS
  • FYLDLYPR
  • ASTEADK
  • ATPGTNMPATFGHLAGGYD
  • DSLRRLSKHY
  • FLDDLSQKLKPLGEAEREFIL
  • QYYGYLWSEV
  • VTYENCLQ
  • MEMAFNTRCKEENT
  • RNGLHLP
  • LQETCDL
  • LCIDFNKNLNED
  • LSKHYKDG
  • YYMTQTEELKYS
  • REPNQKAFLMSRGL
  • AGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGT
  • TLKYPHYFPVMKKCC
  • THADFVLE
  • NEIKSMKKRMSELCIDFNKNLNEDDT
  • KIKPEARRYLEKS
  • HAACFGLQPGCL

Post-translational modifications for NLN Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Domains & Families for NLN Gene

Gene Families for NLN Gene

HGNC:
Human Protein Atlas (HPA):
  • Enzymes
  • Plasma proteins
  • Predicted intracellular proteins

Protein Domains for NLN Gene

Suggested Antigen Peptide Sequences for NLN Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

Q9BYT8

UniProtKB/Swiss-Prot:

NEUL_HUMAN :
  • Belongs to the peptidase M3 family.
Family:
  • Belongs to the peptidase M3 family.
genes like me logo Genes that share domains with NLN: view

Function for NLN Gene

Molecular function for NLN Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Preferential cleavage in neurotensin: 10-Pro- -Tyr-11.
UniProtKB/Swiss-Prot Function:
Hydrolyzes oligopeptides such as neurotensin, bradykinin and dynorphin A.

Enzyme Numbers (IUBMB) for NLN Gene

Phenotypes From GWAS Catalog for NLN Gene

Gene Ontology (GO) - Molecular Function for NLN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004222 metalloendopeptidase activity TAS --
GO:0008233 peptidase activity IEA --
GO:0008237 metallopeptidase activity IEA --
GO:0016787 hydrolase activity IEA --
GO:0042277 peptide binding IEA --
genes like me logo Genes that share ontologies with NLN: view
genes like me logo Genes that share phenotypes with NLN: view

Animal Model Products

  • Taconic Biosciences Mouse Models for NLN

CRISPR Products

miRNA for NLN Gene

miRTarBase miRNAs that target NLN

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for NLN
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for NLN Gene

Localization for NLN Gene

Subcellular locations from UniProtKB/Swiss-Prot for NLN Gene

Mitochondrion intermembrane space. Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for NLN gene
Compartment Confidence
mitochondrion 5
extracellular 4
plasma membrane 3
cytosol 3
nucleus 1

Subcellular locations from the

Human Protein Atlas (HPA)

Gene Ontology (GO) - Cellular Components for NLN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005576 extracellular region TAS --
GO:0005737 cytoplasm IEA --
GO:0005739 mitochondrion IEA --
GO:0005758 mitochondrial intermembrane space IBA --
GO:0005886 plasma membrane IEA --
genes like me logo Genes that share ontologies with NLN: view

Pathways & Interactions for NLN Gene

genes like me logo Genes that share pathways with NLN: view

Pathways by source for NLN Gene

Gene Ontology (GO) - Biological Process for NLN Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006111 regulation of gluconeogenesis IEA --
GO:0006508 proteolysis IEA --
GO:0006518 peptide metabolic process IBA --
GO:1902809 regulation of skeletal muscle fiber differentiation IEA --
genes like me logo Genes that share ontologies with NLN: view

No data available for SIGNOR curated interactions for NLN Gene

Drugs & Compounds for NLN Gene

(3) Drugs for NLN Gene - From: HMDB and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Zinc Approved Pharma 2359
Bradykinin Investigational Pharma Full agonist, Agonist Endogenous agonist at bradykinin receptors (B2 > B1) 52

(4) Additional Compounds for NLN Gene - From: Novoseek

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
genes like me logo Genes that share compounds with NLN: view

Transcripts for NLN Gene

Unigene Clusters for NLN Gene

Neurolysin (metallopeptidase M3 family):
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Clone Products

  • Applied Biological Materials Clones for NLN
  • Vectors and viruses for ORF, Lenti, Retro, Adenovirus, AAV, and more

Alternative Splicing Database (ASD) splice patterns (SP) for NLN Gene

ExUns: 1 ^ 2 ^ 3 ^ 4a · 4b ^ 5 ^ 6a · 6b ^ 7 ^ 8a · 8b ^ 9 ^ 10a · 10b · 10c ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16a · 16b · 16c
SP1: - - - - - -
SP2: - - -
SP3: - - - - -
SP4:
SP5:
SP6:
SP7:

Relevant External Links for NLN Gene

GeneLoc Exon Structure for
NLN
ECgene alternative splicing isoforms for
NLN

Expression for NLN Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for NLN Gene

Protein differential expression in normal tissues from HIPED for NLN Gene

This gene is overexpressed in Brain (35.0) and Fetal Brain (6.5).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for NLN Gene



Protein tissue co-expression partners for NLN Gene

NURSA nuclear receptor signaling pathways regulating expression of NLN Gene:

NLN

SOURCE GeneReport for Unigene cluster for NLN Gene:

Hs.247460

Evidence on tissue expression from TISSUES for NLN Gene

  • Nervous system(4.7)
  • Liver(4.4)
genes like me logo Genes that share expression patterns with NLN: view

Primer Products

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for NLN Gene

Orthologs for NLN Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for NLN Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia NLN 33 34
  • 99.34 (n)
dog
(Canis familiaris)
Mammalia NLN 33 34
  • 91.94 (n)
cow
(Bos Taurus)
Mammalia NLN 33 34
  • 90.91 (n)
mouse
(Mus musculus)
Mammalia Nln 33 16 34
  • 87.15 (n)
rat
(Rattus norvegicus)
Mammalia Nln 33
  • 86.44 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia -- 34
  • 80 (a)
OneToMany
-- 34
  • 76 (a)
OneToMany
oppossum
(Monodelphis domestica)
Mammalia NLN 34
  • 64 (a)
OneToOne
chicken
(Gallus gallus)
Aves NLN 33 34
  • 75.54 (n)
lizard
(Anolis carolinensis)
Reptilia NLN 34
  • 74 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia nln 33
  • 68.96 (n)
zebrafish
(Danio rerio)
Actinopterygii nln 34
  • 57 (a)
OneToOne
fruit fly
(Drosophila melanogaster)
Insecta CG11771 35 34
  • 24 (a)
worm
(Caenorhabditis elegans)
Secernentea ZK550.3 34
  • 16 (a)
OneToMany
K. lactis yeast
(Kluyveromyces lactis)
Saccharomycetes KLLA0C00572g 33
  • 49.35 (n)
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes PRD1 33 34
  • 46.54 (n)
sea squirt
(Ciona savignyi)
Ascidiacea CSA.4245 34
  • 58 (a)
OneToMany
bread mold
(Neurospora crassa)
Ascomycetes NCU06618 33
  • 46.76 (n)
Species where no ortholog for NLN was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for NLN Gene

ENSEMBL:
Gene Tree for NLN (if available)
TreeFam:
Gene Tree for NLN (if available)

Paralogs for NLN Gene

Variants for NLN Gene

Sequence variations from dbSNP and Humsavar for NLN Gene

SNP ID Clin Chr 05 pos Sequence Context AA Info Type
rs1000005800 -- 65,825,526(+) TGACG(-/T)TTTGC utr-variant-3-prime
rs1000026857 -- 65,736,606(+) ATCCA(A/G)TGGTT intron-variant
rs1000058191 -- 65,825,914(+) ATCAT(A/G)CACAG utr-variant-3-prime
rs1000097906 -- 65,740,361(+) CCCAT(C/T)AATTC intron-variant
rs1000124969 -- 65,809,808(+) CCAAC(C/T)GTGCT intron-variant

Structural Variations from Database of Genomic Variants (DGV) for NLN Gene

Variant ID Type Subtype PubMed ID
esv2676386 CNV deletion 23128226
esv2730277 CNV deletion 23290073
esv29005 CNV gain 19812545
esv3566030 CNV deletion 23714750
esv3605303 CNV loss 21293372
nsv507256 OTHER sequence alteration 20534489
nsv820637 CNV deletion 20802225
nsv980652 CNV duplication 23825009

Variation tolerance for NLN Gene

Residual Variation Intolerance Score: 26.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 6.42; 77.19% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for NLN Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
NLN

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for NLN Gene

Disorders for NLN Gene

Relevant External Links for NLN

Genetic Association Database (GAD)
NLN
Human Genome Epidemiology (HuGE) Navigator
NLN
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
NLN

No disorders were found for NLN Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for NLN Gene

Publications for NLN Gene

  1. Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. (PMID: 10574462) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1999) 2 3 4 60
  2. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 45 60
  3. Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. (PMID: 20877624) Hendrickson SL … O'Brien SJ (PloS one 2010) 3 45 60
  4. Swapping the substrate specificities of the neuropeptidases neurolysin and thimet oligopeptidase. (PMID: 17251185) Lim EJ … Rodgers DW (The Journal of biological chemistry 2007) 3 22 60
  5. Endopeptidases 3.4.24.15 and 24.16 in endothelial cells: potential role in vasoactive peptide metabolism. (PMID: 12609826) Norman MU … Lew RA (American journal of physiology. Heart and circulatory physiology 2003) 3 22 60

Products for NLN Gene

Sources for NLN Gene

Content
Loading form....