Free for academic non-profit institutions. Other users need a Commercial license

Aliases for NAPEPLD Gene

Aliases for NAPEPLD Gene

  • N-Acyl Phosphatidylethanolamine Phospholipase D 2 3 4 5
  • NAPE-Hydrolyzing Phospholipase D 3 4
  • NAPE-PLD 3 4
  • C7orf18 3 4
  • Chromosome 7 Open Reading Frame 18, N-Acyl-Phosphatidylethanolamine-Hydrolyzing Phospholipase D 2
  • N-Acyl-Phosphatidylethanolamine-Hydrolyzing Phospholipase D 3
  • EC 3.1.4.54 4
  • EC 3.1.4 61
  • FMP30 3

External Ids for NAPEPLD Gene

Previous GeneCards Identifiers for NAPEPLD Gene

  • GC07M102528
  • GC07M102742
  • GC07M097103

Summaries for NAPEPLD Gene

Entrez Gene Summary for NAPEPLD Gene

  • NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]).[supplied by OMIM, Oct 2008]

GeneCards Summary for NAPEPLD Gene

NAPEPLD (N-Acyl Phosphatidylethanolamine Phospholipase D) is a Protein Coding gene. Among its related pathways are the visual cycle I (vertebrates) and Retinoid cycle disease events. GO annotations related to this gene include phospholipase activity and N-acylphosphatidylethanolamine-specific phospholipase D activity.

UniProtKB/Swiss-Prot for NAPEPLD Gene

  • Hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. Responsible for the generation of anandamide (N-arachidonoylethanolamine), the ligand of cannabinoid and vanilloid receptors (By similarity).

No data available for CIViC summary , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for NAPEPLD Gene

Genomics for NAPEPLD Gene

Regulatory Elements for NAPEPLD Gene

Enhancers for NAPEPLD Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH07G103146 1.7 FANTOM5 ENCODE dbSUPER 15.9 -0.1 -104 7.3 CREB3L1 DMAP1 YY1 SLC30A9 ZNF143 SP3 TBX21 MEF2D ZNF610 GLIS1 RPL23AP95 NAPEPLD DPY19L2P2 PMPCB RASA4DP ARMC10 LOC105375434
GH07G103119 1 dbSUPER 23.6 +29.0 29014 2.3 PKNOX1 ATF1 CREB3L1 ARNT E2F7 TCF12 ZNF766 CBX5 ELK1 GATA2 NAPEPLD ARMC10 RPL19P12 CRYZP1
GH07G102987 1.6 Ensembl ENCODE dbSUPER 14.4 +158.2 158196 6.9 HDGF PKNOX1 FOXA2 CREB3L1 ARNT SIN3A FEZF1 ZNF2 ZNF766 CBX5 PRKRIP1 ENSG00000213385 CRYZP1 ALKBH4 NAPEPLD PMPCB LRRC17 ARMC10 ENSG00000239486 RASA4
GH07G103125 0.6 dbSUPER 22.2 +21.0 21047 5.4 PKNOX1 ZNF146 MTA2 RAD21 ZNF507 FOXA1 ZNF316 EMSY NAPEPLD DPY19L2P2 ARMC10 RPL19P12 CRYZP1
GH07G102423 1.3 ENCODE dbSUPER 10.2 +720.2 720176 12.2 HDGF PKNOX1 CREB3L1 WRNIP1 SIN3A DMAP1 ZNF143 FOS DEK SP3 ORAI2 PRKRIP1 ENSG00000239486 NAPEPLD POLR2J RASA4DP PIR39315 GC07M102430
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around NAPEPLD on UCSC Golden Path with GeneCards custom track

Promoters for NAPEPLD Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000216199 1260 3001 HDGF PKNOX1 CREB3L1 ARNT WRNIP1 ARID4B SIN3A DMAP1 YY1 SLC30A9

Genomic Location for NAPEPLD Gene

Chromosome:
7
Start:
103,099,576 bp from pter
End:
103,149,560 bp from pter
Size:
49,985 bases
Orientation:
Minus strand

Genomic View for NAPEPLD Gene

Genes around NAPEPLD on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
NAPEPLD Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for NAPEPLD Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for NAPEPLD Gene

Proteins for NAPEPLD Gene

  • Protein details for NAPEPLD Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q6IQ20-NAPEP_HUMAN
    Recommended name:
    N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D
    Protein Accession:
    Q6IQ20
    Secondary Accessions:
    • Q5CZ87
    • Q769K1

    Protein attributes for NAPEPLD Gene

    Size:
    393 amino acids
    Molecular mass:
    45596 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Monomer.

    Three dimensional structures from OCA and Proteopedia for NAPEPLD Gene

neXtProt entry for NAPEPLD Gene

Selected DME Specific Peptides for NAPEPLD Gene

Q6IQ20:
  • SHNHYDHLD
  • DDNKVLWGSWSVLGPW
  • ALNERFG
  • MGPKRFRR
  • SRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKN
  • ELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVT
  • MVEMDELI

Post-translational modifications for NAPEPLD Gene

  • Ubiquitination at posLast=7373 and Lys296
  • Modification sites at PhosphoSitePlus

Domains & Families for NAPEPLD Gene

Gene Families for NAPEPLD Gene

Protein Domains for NAPEPLD Gene

Suggested Antigen Peptide Sequences for NAPEPLD Gene

Graphical View of Domain Structure for InterPro Entry

Q6IQ20

UniProtKB/Swiss-Prot:

NAPEP_HUMAN :
  • Belongs to the NAPE-PLD family.
Family:
  • Belongs to the NAPE-PLD family.
genes like me logo Genes that share domains with NAPEPLD: view

Function for NAPEPLD Gene

Molecular function for NAPEPLD Gene

UniProtKB/Swiss-Prot CatalyticActivity:
An N-acylphosphatidylethanolamine + H(2)O = an N-acylethanolamine + a 1,2-diacylglycerol 3-phosphate.
UniProtKB/Swiss-Prot EnzymeRegulation:
Activity is stimulated by divalent cations.
UniProtKB/Swiss-Prot Function:
Hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. Responsible for the generation of anandamide (N-arachidonoylethanolamine), the ligand of cannabinoid and vanilloid receptors (By similarity).

Enzyme Numbers (IUBMB) for NAPEPLD Gene

Gene Ontology (GO) - Molecular Function for NAPEPLD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004620 phospholipase activity IEA --
GO:0008270 zinc ion binding IEA --
GO:0016787 hydrolase activity IEA --
GO:0046872 metal ion binding IEA --
GO:0070290 N-acylphosphatidylethanolamine-specific phospholipase D activity TAS --
genes like me logo Genes that share ontologies with NAPEPLD: view
genes like me logo Genes that share phenotypes with NAPEPLD: view

Animal Models for NAPEPLD Gene

MGI Knock Outs for NAPEPLD:

Animal Model Products

  • Taconic Biosciences Mouse Models for NAPEPLD

CRISPR Products

Inhibitory RNA Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Transcription Factor Targets and HOMER Transcription for NAPEPLD Gene

Localization for NAPEPLD Gene

Subcellular locations from UniProtKB/Swiss-Prot for NAPEPLD Gene

Membrane.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for NAPEPLD gene
Compartment Confidence
extracellular 5
cytosol 5
plasma membrane 4
peroxisome 2
nucleus 2
lysosome 1

Gene Ontology (GO) - Cellular Components for NAPEPLD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005829 cytosol IDA --
GO:0016020 membrane IEA --
GO:0042622 photoreceptor outer segment membrane TAS --
GO:0043227 membrane-bounded organelle IEA --
GO:0070062 extracellular exosome IDA 19056867
genes like me logo Genes that share ontologies with NAPEPLD: view

Pathways & Interactions for NAPEPLD Gene

genes like me logo Genes that share pathways with NAPEPLD: view

Pathways by source for NAPEPLD Gene

Interacting Proteins for NAPEPLD Gene

Gene Ontology (GO) - Biological Process for NAPEPLD Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001523 retinoid metabolic process TAS --
GO:0006629 lipid metabolic process IEA --
GO:0006644 phospholipid metabolic process IEA --
GO:0007568 aging IEA --
GO:0009395 phospholipid catabolic process IEA --
genes like me logo Genes that share ontologies with NAPEPLD: view

No data available for SIGNOR curated interactions for NAPEPLD Gene

Drugs & Compounds for NAPEPLD Gene

(2) Drugs for NAPEPLD Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Water Approved Pharma 0
Anandamide Pharma Antagonist, Pore Blocker Endogenous CB receptor agonist 0

(16) Additional Compounds for NAPEPLD Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
PA(16:0/16:0)
  • 1,2-Di-O-palmitoyl-3-sn-glyceryl-O-phosphorate
  • 1,2-Di-O-palmitoyl-3-sn-glyceryl-O-phosphoric acid
  • 1,2-Dihexadecanoyl-rac-phosphatidic acid
  • 1,2-Dipalmitoyl-3-sn-phosphatidate
  • 1,2-Dipalmitoyl-3-sn-phosphatidic acid
7091-44-3
PA(16:0/18:1(11Z))
  • 1-Hexadecanoyl-2-(11Z-octadecenoyl)-sn-phosphatidic acid
  • 1-Palmitoyl-2-vaccenoyl-sn-glycero-3-phosphate
  • PA(16:0/18:1)
  • PA(16:0/18:1n7)
  • PA(16:0/18:1w7)
PA(16:0/18:1(9Z))
  • 1-Hexadecanoyl-2-(9Z-octadecenoyl)-sn-phosphatidic acid
  • 1-Palmitoyl-2-oleoyl-sn-glycero-3-phosphate
  • PA(16:0/18:1)
  • PA(16:0/18:1n9)
  • PA(16:0/18:1w9)
PA(16:0/18:2(9Z,12Z))
  • 1-Hexadecanoyl-2-(9Z,12Z-octadecadienoyl)-sn-phosphatidic acid
  • 1-Palmitoyl-2-linoleoyl-sn-glycero-3-phosphate
  • PA(16:0/18:2)
  • PA(16:0/18:2n6)
  • PA(16:0/18:2w6)
PA(16:0e/18:0)
  • 2-Octadecanoyl-1-hexadecyl-sn-glycero-3-phosphate
  • PA(O-16:0/18:0)
genes like me logo Genes that share compounds with NAPEPLD: view

Transcripts for NAPEPLD Gene

Unigene Clusters for NAPEPLD Gene

N-acyl phosphatidylethanolamine phospholipase D:
Representative Sequences:

CRISPR Products

Inhibitory RNA Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for NAPEPLD Gene

ExUns: 1 ^ 2a · 2b · 2c ^ 3 ^ 4a · 4b · 4c ^ 5 ^ 6
SP1:
SP2: - - -
SP3: -

Relevant External Links for NAPEPLD Gene

GeneLoc Exon Structure for
NAPEPLD
ECgene alternative splicing isoforms for
NAPEPLD

Expression for NAPEPLD Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for NAPEPLD Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for NAPEPLD Gene

This gene is overexpressed in Frontal cortex (28.0), Bone marrow mesenchymal stem cell (12.6), Brain (8.3), and Adipocyte (6.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for NAPEPLD Gene



Protein tissue co-expression partners for NAPEPLD Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of NAPEPLD Gene:

NAPEPLD

SOURCE GeneReport for Unigene cluster for NAPEPLD Gene:

Hs.324271

Evidence on tissue expression from TISSUES for NAPEPLD Gene

  • Nervous system(4.7)
genes like me logo Genes that share expression patterns with NAPEPLD: view

Primer Products

No data available for mRNA differential expression in normal tissues , mRNA Expression by UniProt/SwissProt and Phenotype-based relationships between genes and organs from Gene ORGANizer for NAPEPLD Gene

Orthologs for NAPEPLD Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for NAPEPLD Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia NAPEPLD 34 35
  • 99.41 (n)
cow
(Bos Taurus)
Mammalia NAPEPLD 34 35
  • 88.29 (n)
mouse
(Mus musculus)
Mammalia Napepld 34 16 35
  • 83.97 (n)
rat
(Rattus norvegicus)
Mammalia Napepld 34
  • 83.97 (n)
dog
(Canis familiaris)
Mammalia NAPEPLD 34 35
  • 79.55 (n)
oppossum
(Monodelphis domestica)
Mammalia NAPEPLD 35
  • 73 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia NAPEPLD 35
  • 60 (a)
OneToOne
chicken
(Gallus gallus)
Aves NAPEPLD 34 35
  • 76.78 (n)
lizard
(Anolis carolinensis)
Reptilia NAPEPLD 35
  • 78 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia napepld 34
  • 72.96 (n)
Str.17648 34
African clawed frog
(Xenopus laevis)
Amphibia Xl.33958 34
zebrafish
(Danio rerio)
Actinopterygii napepld 34 35
  • 64.1 (n)
wufc56b11 34
worm
(Caenorhabditis elegans)
Secernentea nape-2 34 35
  • 51.5 (n)
nape-1 35
  • 41 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes FMP30 35 37
  • 26 (a)
OneToOne
bread mold
(Neurospora crassa)
Ascomycetes NCU07271 34
  • 48.96 (n)
Species where no ortholog for NAPEPLD was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • fruit fly (Drosophila melanogaster)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for NAPEPLD Gene

ENSEMBL:
Gene Tree for NAPEPLD (if available)
TreeFam:
Gene Tree for NAPEPLD (if available)

Paralogs for NAPEPLD Gene

Pseudogenes.org Pseudogenes for NAPEPLD Gene

genes like me logo Genes that share paralogs with NAPEPLD: view

No data available for Paralogs for NAPEPLD Gene

Variants for NAPEPLD Gene

Sequence variations from dbSNP and Humsavar for NAPEPLD Gene

SNP ID Clin Chr 07 pos Sequence Context AA Info Type
rs1000037912 -- 103,106,159(+) CTCCC(C/T)TACCC intron-variant
rs1000055745 -- 103,123,323(+) TGCTC(-/AACAAA)ATTTG intron-variant
rs1000060284 -- 103,109,016(+) GTAAA(C/G)GAATC intron-variant
rs1000147546 -- 103,112,831(+) AGTTA(C/T)GAGGT intron-variant
rs1000164420 -- 103,149,614(+) GCGCC(A/G)AAGCC upstream-variant-2KB

Structural Variations from Database of Genomic Variants (DGV) for NAPEPLD Gene

Variant ID Type Subtype PubMed ID
esv2674575 CNV deletion 23128226
esv2752138 CNV loss 17911159
esv3614368 CNV loss 21293372
esv3614369 CNV loss 21293372
nsv5882 CNV insertion 18451855
nsv831084 CNV gain 17160897
nsv970565 CNV duplication 23825009
nsv981565 CNV duplication 23825009

Variation tolerance for NAPEPLD Gene

Residual Variation Intolerance Score: 48.9% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 6.38; 76.99% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for NAPEPLD Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
NAPEPLD

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for NAPEPLD Gene

Disorders for NAPEPLD Gene

Relevant External Links for NAPEPLD

Genetic Association Database (GAD)
NAPEPLD
Human Genome Epidemiology (HuGE) Navigator
NAPEPLD
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
NAPEPLD

No disorders were found for NAPEPLD Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for NAPEPLD Gene

Publications for NAPEPLD Gene

  1. Isolation and analysis of candidate myeloid tumor suppressor genes from a commonly deleted segment of 7q22. (PMID: 15820312) Curtiss N.P. … Shannon K.M. (Genomics 2005) 2 3 4 64
  2. Molecular characterization of a phospholipase D generating anandamide and its congeners. (PMID: 14634025) Okamoto Y. … Ueda N. (J. Biol. Chem. 2004) 2 3 4 64
  3. Localization of N-acyl phosphatidylethanolamine phospholipase D (NAPE-PLD) expression in mouse brain: A new perspective on N-acylethanolamines as neural signaling molecules. (PMID: 18067139) EgertovA! M. … Elphick M.R. (J. Comp. Neurol. 2008) 2 3 64
  4. Structure of human N-acylphosphatidylethanolamine-hydrolyzing phospholipase D: regulation of fatty acid ethanolamide biosynthesis by bile acids. (PMID: 25684574) Magotti P. … Garau G. (Structure 2015) 3 64
  5. Protein phosphatase 1I^ isoforms linked interactions in the brain. (PMID: 23080069) Esteves S.L. … da Cruz e Silva E.F. (J. Mol. Neurosci. 2013) 3 64

Products for NAPEPLD Gene

Sources for NAPEPLD Gene

Content
Loading form....