Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

NAMPT Gene

protein-coding   GIFtS: 69
GCID: GC07M105888

Nicotinamide Phosphoribosyltransferase

(Previous name: pre-B-cell colony enhancing factor 1)
(Previous symbol: PBEF1)
  See related diseases
at  

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, 10fRNAdb, 12H-InvDB, 13NCBI, 14NONCODE, and/or 15RNAdb)
About This Section

Aliases
Nicotinamide Phosphoribosyltransferase1 2     EC 2.4.2.123 8
PBEF11 2 3 5     VF2 5
PBEF2 3 5     visfatin1
Pre-B-Cell Colony Enhancing Factor 11 2     1110035O14Rik2
Pre-B Cell-Enhancing Factor2 3     VISFATIN2
Pre-B-Cell Colony-Enhancing Factor 12 3     Nampt3
NAmPRTase2 3     Visfatin3

External Ids:    HGNC: 300921   Entrez Gene: 101352   Ensembl: ENSG000001058357   OMIM: 6087645   UniProtKB: P434903   

Export aliases for NAMPT gene to outside databases

Previous GC identifers: GC07M105675 GC07M100248


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for NAMPT Gene:
This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate
to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The
protein belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved
in many important biological processes, including metabolism, stress response and aging. This gene has a
pseudogene on chromosome 10. (provided by RefSeq, Feb 2011)

GeneCards Summary for NAMPT Gene: 
NAMPT (nicotinamide phosphoribosyltransferase) is a protein-coding gene. Diseases associated with NAMPT include gestational diabetes, and polyploidy, and among its related super-pathways are NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde and NAD metabolism. GO annotations related to this gene include nicotinate phosphoribosyltransferase activity and cytokine activity. An important paralog of this gene is NAMPTL.

UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490
Function: Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide
mononucleotide, an intermediate in the biosynthesis of NAD. It is the rate limiting component in the mammalian
NAD biosynthesis pathway (By similarity)

Gene Wiki entry for NAMPT (Nicotinamide phosphoribosyltransferase) Gene


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 73), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000007.13  NT_007933.15  NC_018918.2  NT_079596.2  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the NAMPT gene promoter:
         Nkx3-1   Nkx3-1 v4   AP-1   ATF-2   Nkx3-1 v1   Nkx3-1 v2   Max   Nkx3-1 v3   c-Jun   c-Myc   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 3): NAMPT promoter sequence
   Search SABiosciences Chromatin IP Primers for NAMPT

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat NAMPT


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 7q22.3   Ensembl cytogenetic band:  7q22.3   HGNC cytogenetic band: 7q22.3

NAMPT Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
NAMPT gene location

GeneLoc information about chromosome 7         GeneLoc Exon Structure

GeneLoc location for GC07M105888:  view genomic region     (about GC identifiers)

Start:
105,888,731 bp from pter      End:
105,926,772 bp from pter
Size:
38,042 bases      Orientation:
minus strand

1 alternative location:
Chr7-,CRA_TCAG 105,249,752-105,286,646     

(According to UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE 1MOPED, 2PaxDb, and 3MAXQB RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Cloud-Clone Corp.,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Cloud-Clone Corp., Ontologies according to Gene Ontology Consortium 01 Oct 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, LSBio, Abcam, and/or Cloud-Clone Corp.)
About This Section

UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490 (See protein sequence)
Recommended Name: Nicotinamide phosphoribosyltransferase  
Size: 491 amino acids; 55521 Da
Subunit: Homodimer
Subcellular location: Cytoplasm (By similarity)
Caution: Was originally (PubMed:8289818) thought to be a cytokine which acts on early B-lineage precursor cells,
by enhancing the effect of IL-7 and SCF on pre-B-cell colony formation
Sequence caution: Sequence=AAQ96862.1; Type=Erroneous gene model prediction; Sequence=EAL24400.1; Type=Erroneous
gene model prediction;
6/14 PDB 3D structures from and Proteopedia for NAMPT (see all 14):
2E5B (3D)        2E5C (3D)        2E5D (3D)        2GVG (3D)        2GVJ (3D)        3DGR (3D)    
Secondary accessions: A4D0Q9 A4D0R0 Q3KQV0 Q8WW95

Explore the universe of human proteins at neXtProt for NAMPT: NX_P43490

Explore proteomics data for NAMPT at MOPED 

Post-translational modifications:

  • View modification sites using PhosphoSitePlus
  • View neXtProt modification sites for NX_P43490

  • 4/6 DME Specific Peptides for NAMPT (P43490) (see all 6)
     DLLHTVFKNGKVTKSYSFDE  APLIIRPDSGNPLDTVLKVL  RKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAK  AAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKK 

    NAMPT Protein expression data from MOPED1, PaxDb2 and MAXQB3 :    About this image 

    NAMPT Protein Expression
    REFSEQ proteins: NP_005737.1  
    ENSEMBL proteins: 
     ENSP00000222553   ENSP00000346242   ENSP00000390591   ENSP00000390896  
    Reactome Protein details: P43490
    Human Recombinant Protein Products for NAMPT: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Enzo Life Sciences proteins for NAMPT
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    Browse OriGene Protein Over-expression Lysates
    OriGene Custom MassSpec 
    OriGene Custom Protein Services for NAMPT
    GenScript Custom Purified and Recombinant Proteins Services for NAMPT
    Novus Biologicals NAMPT Proteins
    Sino Biological Recombinant Protein for NAMPT
    Sino Biological Cell Lysate for NAMPT 
    ProSpec Recombinant Protein for NAMPT
    Browse Proteins at Cloud-Clone Corp. 

    Gene Ontology (GO): 2 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005737cytoplasm ----
    GO:0005829cytosol TAS--

    NAMPT for ontologies           About GeneDecksing



    NAMPT Antibody Products: 
    EMD Millipore Mono- and Polyclonal Antibodies for the study of NAMPT
    R&D Systems Antibodies for NAMPT (PBEF/Visfatin)
    OriGene Antibodies for NAMPT
    OriGene Custom Antibody Services for NAMPT
    GenScript Custom Superior Antibodies Services for NAMPT
    Novus Biologicals NAMPT Antibodies
    Abcam antibodies for NAMPT
    Browse Antibodies at Cloud-Clone Corp. 
    ThermoFisher Antibody for NAMPT
    LSBio Antibodies in human, mouse, rat for NAMPT 

    Assay Products for NAMPT: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Assay Services for NAMPT
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for NAMPT
    Enzo Life Sciences assays for NAMPT
    Browse ELISAs at Cloud-Clone Corp. 
    Browse CLIAs at Cloud-Clone Corp.


    (According to HGNC, IUPHAR, InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section
    3 InterPro protein domains:
     IPR002638 Quinolinate_PRibosylTrfase_C
     IPR016471 Nicotinamide_PRibTrfase
     IPR015977 Nic_PRibTrfase-like

    Graphical View of Domain Structure for InterPro Entry P43490

    ProtoNet protein and cluster: P43490

    UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490
    Similarity: Belongs to the NAPRTase family


    NAMPT for domains           About GeneDecksing


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013, inGenious Targeting Laboratory, genOway,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase, shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Sirion Biotech, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, Vector BioLabs, and Sirion Biotech, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene.)
    About This Section

    Molecular Function:

         UniProtKB/Swiss-Prot Summary: NAMPT_HUMAN, P43490
    Function: Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide
    mononucleotide, an intermediate in the biosynthesis of NAD. It is the rate limiting component in the mammalian
    NAD biosynthesis pathway (By similarity)
    Catalytic activity: Nicotinamide D-ribonucleotide + diphosphate = nicotinamide + 5-phospho-alpha-D-ribose
    1-diphosphate
    Enzyme regulation: Inhibited by FK866. FK866 competes for the same binding site as nicotinamide, but due to its
    very low dissociation rate, it is essentially an irreversible inhibitor

         Enzyme Number (IUBMB): EC 2.4.2.121 2

         Gene Ontology (GO): 5 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004514nicotinate-nucleotide diphosphorylase (carboxylating) activity IEA--
    GO:0004516nicotinate phosphoribosyltransferase activity IEA--
    GO:0005125cytokine activity TAS8289818
    GO:0005515protein binding IPI18486613
    GO:0047280nicotinamide phosphoribosyltransferase activity IEA--
         
    NAMPT for ontologies           About GeneDecksing


    Phenotypes:
         1 GenomeRNAi human phenotype for NAMPT:
     High actin ratio cells 

         6 MGI mutant phenotypes (inferred from 3 alleles(MGI details for Nampt):
     cellular  endocrine/exocrine gland  hematopoietic system  homeostasis/metabolism  immune system 
     mortality/aging 

    NAMPT for phenotypes           About GeneDecksing

    Animal Models:
       inGenious Targeting Laboratory - Custom generated mouse model solutions for NAMPT 
       inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for NAMPT

       genOway customized KO model: permanent, tissue-specific or time-controlled inactivation for NAMPT 
       genOway customized Knockin model: humanization, point mutation, expression monitoring, etc. for NAMPT 

    miRNA
    Products:
        
    miRTarBase miRNAs that target NAMPT:
    hsa-mir-155 (MIRT005102)

    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat NAMPT
    8/83 QIAGEN miScript miRNA Assays for microRNAs that regulate NAMPT (see all 83):
    hsa-miR-607 hsa-miR-300 hsa-miR-200a hsa-miR-578 hsa-miR-3142 hsa-miR-556-3p hsa-miR-374b* hsa-miR-647
    SwitchGear 3'UTR luciferase reporter plasmidNAMPT 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for NAMPT
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat NAMPT

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for NAMPT
    Sirion Biotech Customized adenovirus for overexpression of NAMPT

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene clones in human, mouse for NAMPT (see all 6)
    OriGene ORF clones in mouse, rat for NAMPT
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: NAMPT (NM_005746)
    Sino Biological Human cDNA Clone for NAMPT
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for NAMPT
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NAMPT
    Sirion Biotech Customized lentivirus for stable overexpression of NAMPT 
                         Customized lentivirus expression plasmids for stable overexpression of NAMPT 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for NAMPT
    Search LifeMap BioReagents cell lines for NAMPT
    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NAMPT


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Sino Biological, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Oct 2013 via Entrez Gene).
    About This Section

    SuperPaths for NAMPT About   (see all 8)                                                                                              See pathways by source

    SuperPathContained pathways About
    1Nicotinate metabolism
    Nicotinate metabolism0.62
    NAD biosynthesis III0.50
    2NAD metabolism
    NAD metabolism0.43
    Nicotinate and nicotinamide metabolism0.43
    3Metabolism of vitamins and cofactors
    Metabolism of water-soluble vitamins and cofactors1.00
    Metabolism of vitamins and cofactors1.00
    4Circadian Clock
    Circadian Clock0.40
    BMAL1:CLOCK/NPAS2 Activates Circadian Expression0.40
    5Metabolism
    Metabolism0.40

    Pathways by source                                                                                                                                                                 See SuperPaths
    Show all pathways

    1 EMD Millipore Pathway for NAMPT
        NAD metabolism

    1 R&D Systems Pathway for NAMPT
        Adipocytokines & Insulin Signaling


    1 GeneGo (Thomson Reuters) Pathway for NAMPT
        NAD metabolism

    2 BioSystems Pathways for NAMPT
        Adipogenesis
    NAD biosynthesis III


    5/7        Reactome Pathways for NAMPT (see all 7)
        Circadian Clock
    Nicotinamide salvaging
    Nicotinate metabolism
    Metabolism
    Metabolism of vitamins and cofactors


    1         Kegg Pathway  (Kegg details for NAMPT):
        Nicotinate and nicotinamide metabolism

    UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490
    Pathway: Cofactor biosynthesis; NAD(+) biosynthesis; nicotinamide D-ribonucleotide from 5-phospho-alpha-D-ribose
    1-diphosphate and nicotinamide: step 1/1


    NAMPT for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for NAMPT

    STRING Interaction Network Preview (showing 5 interactants - click image to see 11)

    5/19 Interacting proteins for NAMPT (P434902, 3 ENSP000002225534) via UniProtKB, MINT, STRING, and/or I2D (see all 19)

    InteractantInteraction Details
    GeneCardExternal ID(s)
    FTLP027922, 3, ENSP000003665254MINT-6538799 MINT-6538712 MINT-6538862 I2D: score=1 STRING: ENSP00000366525
    MT-ND1P038862, 3, ENSP000003546874MINT-6538787 MINT-6538841 MINT-6538697 I2D: score=1 STRING: ENSP00000354687
    ADORA2AP292742, 3, ENSP000003366304MINT-6538741 I2D: score=1 STRING: ENSP00000336630
    UBE2L6O149332, 3, ENSP000002871564MINT-6538769 I2D: score=1 STRING: ENSP00000287156
    IFITM3Q016282, 3, ENSP000003827074MINT-6538727 MINT-6538811 MINT-6538868 I2D: score=1 STRING: ENSP00000382707
    About this table

    Gene Ontology (GO): 5/13 biological process terms (GO ID links to tree view) (see all 13):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006766vitamin metabolic process TAS--
    GO:0006767water-soluble vitamin metabolic process TAS--
    GO:0006769nicotinamide metabolic process TAS--
    GO:0007165signal transduction TAS8289818
    GO:0007267cell-cell signaling TAS8289818

    NAMPT for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, Ligands according to IUPHAR, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    NAMPT for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Enzo Life Sciences drugs & compounds for NAMPT

    Browse Tocris compounds for NAMPT

    6 HMDB Compounds for NAMPT    About this table
    CompoundSynonyms CAS #PubMed Ids
    NAD3-Carbamoyl-1-D-ribofuranosylpyridinium hydroxide 5'-ester with adenosine 5'-pyrophosphate (see all 28)53-84-9--
    Niacinamide3-Carbamoylpyridine (see all 77)98-92-0--
    Nicotinamide ribotide3-(aminocarbonyl)-1-(5-O-phosphono-b-D-ribofuranosyl)-Pyridinium hydroxide inner salt (see all 15)1094-61-7--
    Phosphoribosyl pyrophosphate5-Phospho-a-D-ribose-1-diphosphate (see all 37)7540-64-9--
    Phosphoric acidacide phosphorique (FRENCH) (see all 20)7664-38-2--
    Pyrophosphate(4-)Diphosphoric acid ion (see all 10)14000-31-8--

    1 DrugBank Compound for NAMPT    About this table
    CompoundSynonyms CAS #TypeActionsPubMed Ids
    N-[4-(1-BENZOYLPIPERIDIN-4-YL)BUTYL]-3-PYRIDIN-3-YLPROPANAMIDE-- --target--10592235

    10/21 Novoseek inferred chemical compound relationships for NAMPT gene (see all 21)    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    fk-866 93.7 17 19936064 (3), 14612543 (2), 18247435 (1), 18768589 (1) (see all 8)
    nicotinamide 87.7 187 19666527 (3), 19149599 (3), 12555668 (3), 19727662 (2) (see all 63)
    nicotinamide mononucleotide 83.4 33 16901503 (2), 18823127 (2), 16783373 (2), 19727662 (1) (see all 10)
    nad+ 72.9 88 17268245 (4), 19855187 (3), 19182797 (3), 19703994 (2) (see all 28)
    glucose 61 168 19302375 (5), 19650786 (5), 19461540 (4), 16736128 (4) (see all 66)
    prpp 52.1 3 17565174 (1), 12555668 (1)
    rosiglitazone 49.5 13 16735449 (4), 18942491 (3), 17235334 (2), 19815243 (2) (see all 6)
    niacin 48.4 5 15837705 (1), 10218108 (1), 2183889 (1)
    pioglitazone 47.3 20 17952841 (4), 17378999 (3), 18031315 (2), 19158194 (2) (see all 5)
    lipid 38.4 32 17429683 (3), 18246224 (2), 19804767 (2), 19815243 (2) (see all 22)

    Search CenterWatch for drugs/clinical trials and news about NAMPT

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 236 Homo sapiens; Apr 25 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    Conferences by KenesGroup, exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Sirion Biotech, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for NAMPT gene (2 alternative transcripts): 
    NM_005746.2  NM_182790.1  

    Unigene Cluster for NAMPT:

    Nicotinamide phosphoribosyltransferase
    Hs.489615  [show with all ESTs]
    Unigene Representative Sequence: NM_005746
    13 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000222553(uc003vdq.3 uc003vdr.1 uc011klu.1) ENST00000463871
    ENST00000354289 ENST00000491027 ENST00000467730 ENST00000484527 ENST00000393618
    ENST00000441045 ENST00000486949 ENST00000489358 ENST00000424768 ENST00000489732
    ENST00000417537
    miRNA
    Products:
         
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat NAMPT
    8/83 QIAGEN miScript miRNA Assays for microRNAs that regulate NAMPT (see all 83):
    hsa-miR-607 hsa-miR-300 hsa-miR-200a hsa-miR-578 hsa-miR-3142 hsa-miR-556-3p hsa-miR-374b* hsa-miR-647
    SwitchGear 3'UTR luciferase reporter plasmidNAMPT 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene RNAi products in human, mouse, rat for NAMPT
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat NAMPT
    Clone
    Products:
         
    OriGene clones in human, mouse for NAMPT (see all 6)
    OriGene ORF clones in mouse, rat for NAMPT
    OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
    GenScript: all cDNA clones in your preferred vector: NAMPT (NM_005746)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for NAMPT
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NAMPT
    Sirion Biotech Customized lentivirus for stable overexpression of NAMPT 
                         Customized lentivirus expression plasmids for stable overexpression of NAMPT 
    Primer
    Products:
        
    OriGene qPCR primer pairs and template standards for NAMPT
    OriGene qSTAR qPCR primer pairs in human, mouse for NAMPT
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat NAMPT
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat NAMPT
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat NAMPT

    Additional mRNA sequence: 

    AK292851.1 AK304085.1 BC072439.1 BC106046.1 L29050.1 U02020.1 

    24/35 DOTS entries (see all 35):

    DT.100703768  DT.119356  DT.100037990  DT.100883858  DT.121066768  DT.95329224  DT.100662669  DT.86852592 
    DT.100883852  DT.92036344  DT.428653  DT.97802778  DT.121066749  DT.91768071  DT.91974524  DT.92014376 
    DT.95251570  DT.121066780  DT.99961287  DT.100802957  DT.100883849  DT.100883856  DT.121066728  DT.121066757 

    24/691 AceView cDNA sequences (see all 691):

    AA489629 BQ028374 AA227734 AA045438 BG568717 AI610668 BE049565 CA841854 
    BP343540 BP341305 BG370231 AI343646 AI129311 AA927239 BM452700 AW272904 
    BM834402 AA281120 CA443907 BQ786796 BM471070 AI282896 AI811930 AI093801 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    NAMPT expression in normal human tissues (normalized intensities)      NAMPT embryonic expression: see
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS <intensity>2/3
    CGAP TAG: GCCTTAACAA
    NAMPT Expression
    About this image


    NAMPT expression in embryonic tissues and stem cells    About this table
    Data from LifeMap, the Embryonic Development and Stem Cells Database 
     5/15 selected tissues (see all 15) fully expand
     
     Brain (Nervous System)    fully expand to see all 5 entries
             Postnatal Endothelial Cells Blood Brain Barrier
             Cerebral Cortex
             brain/midbrain   
     
     Adipose (Muscoskeletal System)    fully expand to see all 3 entries
             Adipose-derived stromal vascular fraction and adipocytes (HiQCell)
             HyStem+BMP4-induced 7SMOO32 cells
             Human Preadipocyte-visceral (HPA-v)   
     
     Gut Tube (Gastrointestinal Tract)
             Definitive endoderm-like cells ( A scalable, suspension protocol for derivation of...
     
     Lower Urinary Tract (Urinary System)
             visceral organ   
     
     Neural Tube (Nervous System)
             Telencephalon

    See NAMPT Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for NAMPT

    SOURCE GeneReport for Unigene cluster: Hs.489615

    UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490
    Tissue specificity: Expressed in large amounts in bone marrow, liver tissue, and muscle. Also present in heart,
    placenta, lung, and kidney tissues

        SABiosciences Expression via Pathway-Focused PCR Arrays including NAMPT (see all 6): 
              Notch Signaling Targets in human mouse rat
              Insulin Resistance in human mouse rat
              Inflammatory Cytokines & Receptors in human mouse rat
              Common Cytokines in human mouse rat
              Hypoxia Signaling Pathway in human mouse rat

    Primer
    Products:
    OriGene qPCR primer pairs and template standards for NAMPT
    OriGene qSTAR qPCR primer pairs in human, mouse for NAMPT
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat NAMPT
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat NAMPT
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat NAMPT
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NAMPT

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of chordates.

    Orthologs for NAMPT gene from 5/12 species (see all 12)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Nampt1 , 5 nicotinamide phosphoribosyltransferase1, 5 91.38(n)1
    95.72(a)1
      12 (13.74 cM)5
    590271  NM_021524.21  NP_067499.21 
     328203355 
    chicken
    (Gallus gallus)
    Aves NAMPT1 nicotinamide phosphoribosyltransferase 84.43(n)
    94.47(a)
      417707  NM_001030728.1  NP_001025899.1 
    lizard
    (Anolis carolinensis)
    Reptilia --
    --
    90(a)
    1 → many
    5(96938974-96963822)
    African clawed frog
    (Xenopus laevis)
    Amphibia LOC3985022 similar to pre-B-cell colony-enhancing factor 79.45(n)    BC045090.1 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.86942 Danio rerio mRNA similar to pre-B-cell colony-enhancing more 71.5(n)    BC044476.1 


    ENSEMBL Gene Tree for NAMPT (if available)
    TreeFam Gene Tree for NAMPT (if available)

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for NAMPT gene
    NAMPTL2  
    1 SIMAP similar gene for NAMPT using alignment to 3 protein entries:     NAMPT_HUMAN (see all proteins):
    NAMPTL

    NAMPT for paralogs           About GeneDecksing


    2 Pseudogenes.org Pseudogenes for NAMPT
    PGOHUM00000258464 PGOHUM00000235414


    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, 4UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/771 SNPs in NAMPT are shown (see all 771)    About this table     
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 7 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    VAR_0366144
    A colorectal cancer sample4--see VAR_0366142 L S mis40--------
    rs1175538871,2
    F--105888295(+) CAATAC/GAGTTA 1 -- ds50011Minor allele frequency- G:0.01NA 120
    rs1434769901,2
    --105888340(+) ATGGCA/GTGGGG 1 -- ds50010--------
    rs1893456151,2
    --105888342(+) GGCGTC/GGGGTT 1 -- ds50010--------
    rs1808920651,2
    --105888530(+) TAACAC/TGGGAA 1 -- ds50010--------
    rs1863865701,2
    --105888537(+) GGAATC/TGTGCT 1 -- ds50010--------
    rs1464549781,2
    C--105888593(+) AAGGCA/CCTGTC 1 -- ds50010--------
    rs1908356661,2
    --105888604(+) ATCTAC/TACAGT 1 -- ds50010--------
    rs1815944941,2
    --105888605(+) TCTATA/TCAGTT 1 -- ds50010--------
    rs758201771,2
    C--105888627(+) AAAAGG/TAGTCA 1 -- ds50010--------

    HapMap Linkage Disequilibrium report for NAMPT (105888731 - 105926772 bp)

    Structural Variations
         Database of Genomic Variants (DGV) 1 variation for NAMPT:    About this table     
    Variant IDTypeSubtypePubMed ID
    nsv888937CNV Loss21882294


    Human Gene Mutation Database (HGMD): NAMPT
    SABiosciences Cancer Mutation PCR Assays
    SeqTarget long-range PCR primers for resequencing NAMPT
    DNA2.0 Custom Variant and Variant Library Synthesis for NAMPT

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Conferences by KenesGroup, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section
    OMIM gene information: 608764    OMIM disorders: --

    20/65 diseases for NAMPT (see all 65):    About MalaCards
    gestational diabetes    polyploidy    acute pyelonephritis    ascariasis
    morbid obesity    trichuriasis    obesity, association with    pyelonephritis
    polycystic ovary syndrome    bulimia nervosa    insulin resistance    fatty liver disease
    hyperandrogenism    hyperthyroidism    acromegaly    sleep apnea
    vascular disease    metabolic disorders    hyperglycemia    lipodystrophy

    3 diseases from the University of Copenhagen DISEASES database for NAMPT:
    Diabetes mellitus     Atherosclerosis     Polycystic ovary syndrome

    NAMPT for disorders           About GeneDecksing

    10/26 Novoseek inferred disease relationships for NAMPT gene (see all 26)    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    insulin resistance 80.8 108 17634078 (4), 16720654 (4), 20346233 (3), 19222486 (3) (see all 58)
    obesity 74.3 125 20346233 (5), 17512309 (3), 17878256 (3), 19444230 (3) (see all 53)
    insulin sensitivity 68.2 30 17327330 (3), 20151765 (3), 17586594 (2), 18803942 (2) (see all 20)
    inflammation 60.5 83 18248642 (4), 20470278 (4), 20346239 (3), 17634078 (3) (see all 42)
    polycystic ovary syndrome 54 2 18848173 (1), 19111298 (1)
    niddm 51.8 21 18691043 (2), 18246224 (1), 16401830 (1), 18686225 (1) (see all 12)
    atherosclerosis 50 16 19351806 (2), 19178507 (2), 18663287 (1), 20145358 (1) (see all 12)
    cardiovascular diseases 48.7 8 15968578 (1), 16311222 (1), 17970534 (1), 16391616 (1) (see all 8)
    diabetes gestational 48 12 16489932 (2), 18787378 (2), 16814166 (1), 17416788 (1) (see all 8)
    necrosis 43.5 33 17283255 (2), 18272217 (1), 17882804 (1), 17878891 (1) (see all 29)

    Genetic Association Database (GAD): NAMPT
    Human Genome Epidemiology (HuGE) Navigator: NAMPT (2 documents)

    Export disorders for NAMPT gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for NAMPT gene, integrated from 9 sources (see all 506):
    (articles sorted by number of sources associating them with NAMPT)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Cloning and characterization of the cDNA encoding a novel human pre- B-cell colony-enhancing factor. (PubMed id 8289818)1, 2, 3, 9 Samal B.... McNiece I. (1994)
    2. The visfatin (PBEF1) G-948T gene polymorphism is associated with increased high-density lipoprotein cholesterol in obese subjects. (PubMed id 18940394)1, 4, 9 Johansson L.M....Ridderstrale M. (2008)
    3. Genetic variant in visfatin gene promoter is associat ed with decreased risk of coronary artery disease in a Chinese population. (PubMed id 19804767)1, 4, 9 Yan J.J....Huang J. (2010)
    4. A Rare Variant in the Visfatin Gene (NAMPT/PBEF1) Is Associated With Protection From Obesity. (PubMed id 19300429)1, 4, 9 Blakemore A.I....Walley A.J. (2009)
    5. Molecular basis for the inhibition of human NMPRTase, a novel target for anticancer agents. (PubMed id 16783377)1, 2, 9 Khan J.A.... Tong L. (2006)
    6. The -1535 promoter variant of the visfatin gene is associated with serum triglyceride and HDL-cholesterol levels in Japanese subjects. (PubMed id 18270432)1, 4 Tokunaga A....Yamagata K. (2008)
    7. Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations. (PubMed id 18660489)1, 4 Lu Y....Boer J.M. (2008)
    8. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    9. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    10. The DNA sequence of human chromosome 7. (PubMed id 12853948)1, 2 Hillier L.W.... Wilson R.K. (2003)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 10135 HGNC: 30092 AceView: PBEF1 Ensembl:ENSG00000105835 euGenes: HUgn10135
    ECgene: NAMPT Kegg: 10135 H-InvDB: NAMPT

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for NAMPT Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for NAMPT Genetics and Cytogenetics in Oncology and Haematology

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for NAMPT gene:
    Search GeneIP for patents involving NAMPT

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Cloud-Clone Corp., Thermo Fisher Scientific, LSBio, Gene Editing from DNA2.0 and Sirion Biotech, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Sirion Biotech, Cell lines from GenScript, and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences, In Situ Hybridization Assays from
    Advanced Cell Diagnostics, Animal models from inGenious Targeting Laboratory, genOway)
    About This Section

     Browse for Gene Knock-down Tools from EMD Millipore
     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     Browse Kits and Assays available from EMD Millipore
     Browse Small Molecules at EMD Millipore
     Browse Purified and Recombinant Proteins at EMD Millipore
     EMD Millipore Mono- and Polyclonal Antibodies for the study of NAMPT
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Antibodies for NAMPT (PBEF/Visfatin)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Protease Activity Assays and Reagents   Browse Recombinant/Natural Proteins  
     Browse Stem Cell Products   Browse Tocris Biochemicals & Compounds  
     Browse cDNA Clones   Browse Proteome Profiler Antibody Arrays  
     OriGene Antibodies for NAMPT   OriGene RNAi products in human, mouse, rat for NAMPT  
     OriGene qPCR primer pairs and template standards for NAMPT   Browse OriGene Protein Over-expression Lysates  
     OriGene Custom Mass Spec   OriGene clones in human, mouse for NAMPT  
     OriGene qSTAR qPCR primer pairs in human, mouse for NAMPT   Browse OriGene full length recombinant human proteins expressed in human HEK293 cells  
     OriGene ORF clones in mouse, rat for NAMPT   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for NAMPT   OriGene Custom Protein Services for NAMPT  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat NAMPT
     QIAGEN SeqTarget long-range PCR primers for resequencing NAMPT
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat NAMPT
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat NAMPT
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat NAMPT
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat NAMPT
     GenScript Custom Purified and Recombinant Proteins Services for NAMPT GenScript cDNA clones with any tag delivered in your preferred vector for NAMPT
     GenScript Custom Assay Services for NAMPT GenScript Custom Superior Antibodies Services for NAMPT
     GenScript Custom overexpressing Cell Line Services for NAMPT CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in NAMPT promoter
     Search Chromatin IP Primers for NAMPT
     RT2 qPCR Primer Assay in human, mouse, rat NAMPT
     GNC Network for NAMPT
     SABiosciences PCR Arrays including human, mouse, rat NAMPT
     Search Tocris compounds for NAMPT
     Proteins and Antibodies for NAMPT
     Cell Lysates for NAMPT
     cDNA Clones for NAMPT
     4000+ Proteins
     Search Sino Biological for antibodies, proteins & pathways
     Protein Production Services
     Transfection Reagents
     Protein A/G/L resins
     Isotyping reagents
     Assays/Drugs/Proteins for NAMPT
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     NAMPT antibodies
     NAMPT proteins
     Antibodies for NAMPT
     See all of Abcam's Antibodies, Kits and Proteins for NAMPT
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for NAMPT




     Browse Proteins at Cloud-Clone Corp.
     Browse Antibodies at Cloud-Clone Corp.
     Browse ELISAs at Cloud-Clone Corp.
     Browse CLIAs at Cloud-Clone Corp.
     Search LifeMap BioReagents cell lines for NAMPT
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NAMPT
     SwitchGear 3'UTR luciferase reporter plasmids for NAMPT
     SwitchGear Promoter luciferase reporter plasmids for NAMPT
     ThermoFisher Antibody for NAMPT
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NAMPT
     inGenious Targeting Laboratory - Custom generated mouse model solutions for NAMPT
     inGenious Targeting Laboratory - Custom generated inducible mouse model solutions for NAMPT
    Customized:
     lentivirus for stable overexpression of NAMPT
     lentivirus expression plasmids for stable overexpression of NAMPT
     adenovirus for overexpression of NAMPT
     LSBio Antibodies in human, mouse, rat for NAMPT
    Customized transgenic rodents for:
     Humanization
     Biomarker expression
     Off-target effect monitoring
     Translational medicine
     Tissue-specific gene expresssion
     Time-controlled gene expresssion
           
    GeneCards Homepage - Last full update: 23 Oct 2013 - Incrementals: 3 Nov 2013 , 7 Nov 2013 , 23 Jan 2014

    View Random Gene

    Category
    (GIFtS: 73)
    transforming growth factor, beta 1
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      NAMPT gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 106 solr: 1.4