Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

NAMPT Gene

protein-coding   GIFtS: 68
GCID: GC07M105888

nicotinamide phosphoribosyltransferase

(Previous name: pre-B-cell colony enhancing factor 1 )
(Previous symbol: PBEF1)
 Explore 67 diseases affiliated with
NAMPT via our new
 Human Malady Compendium 
Biological research products
for NAMPT
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Nicotinamide Phosphoribosyltransferase1 2     EC 2.4.2.123 8
PBEF1 2 3 5     VF2 5
PBEF11 2 3 5     1110035O14Rik2
Pre-B-Cell Colony Enhancing Factor 11 2     VISFATIN2
Pre-B Cell-Enhancing Factor2 3     Nampt3
Pre-B-Cell Colony-Enhancing Factor 12 3     Visfatin3
NAmPRTase2 3     

External Ids:    HGNC: 300921   Entrez Gene: 101352   Ensembl: ENSG000001058357   OMIM: 6087645   UniProtKB: P434903   

Export aliases for NAMPT gene to outside databases

Previous GC identifers: GC07M105675 GC07M100248


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for NAMPT:
This gene encodes a protein that catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to
yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein
belongs to the nicotinic acid phosphoribosyltransferase (NAPRTase) family and is thought to be involved in many
important biological processes, including metabolism, stress response and aging. This gene has a pseudogene on
chromosome 10. (provided by RefSeq, Feb 2011)

UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490
Function: Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide
mononucleotide, an intermediate in the biosynthesis of NAD. It is the rate limiting component in the mammalian NAD
biosynthesis pathway (By similarity)

Gene Wiki entry for NAMPT (Nicotinamide phosphoribosyltransferase)


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000007.13  NC_018918.1  NT_007933.15  NT_079596.2  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the NAMPT gene promoter:
         Nkx3-1   Nkx3-1 v4   AP-1   ATF-2   Nkx3-1 v1   Nkx3-1 v2   Max   Nkx3-1 v3   c-Jun   c-Myc   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmids (see all 3): NAMPT promoter sequence
   Search SABiosciences Chromatin IP Primers for NAMPT

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat NAMPT


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 7q22.3   Ensembl cytogenetic band:  7q22.3   HGNC cytogenetic band: 7q22.3

NAMPT Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
NAMPT gene location

GeneLoc information about chromosome 7         GeneLoc Exon Structure

GeneLoc location for GC07M105888:  view genomic region     (about GC identifiers)

Start:
105,888,731 bp from pter      End:
105,926,772 bp from pter
Size:
38,042 bases      Orientation:
minus strand

1 alternative location:
Chr7-,CRA_TCAG 105,249,752-105,286,646     

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490 (See protein sequence)
Recommended Name: Nicotinamide phosphoribosyltransferase  
Size: 491 amino acids; 55521 Da
Subunit: Homodimer
Subcellular location: Cytoplasm (By similarity)
Caution: Was originally (PubMed:8289818) thought to be a cytokine which acts on early B-lineage precursor cells, by
enhancing the effect of IL-7 and SCF on pre-B-cell colony formation
Sequence caution: Sequence=AAQ96862.1; Type=Erroneous gene model prediction; Sequence=EAL24400.1; Type=Erroneous gene
model prediction;
6/10 PDB 3D structures from and Proteopedia for NAMPT (see all 10):
2E5B (3D)        2E5C (3D)        2E5D (3D)        2GVG (3D)        2GVJ (3D)        3DGR (3D)    
Secondary accessions: A4D0Q9 A4D0R0 Q3KQV0 Q8WW95

Explore the universe of human proteins at neXtProt for NAMPT: NX_P43490

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_P43490

  • 4/6 DME Specific Peptides for NAMPT (P43490) (see all 6)
     DLLHTVFKNGKVTKSYSFDE  APLIIRPDSGNPLDTVLKVL  RKVKYEETVFYGLQYILNKYLKGKVVTKEKIQEAK  AAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKK 

    NAMPT Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins: NP_005737.1  
    ENSEMBL proteins: 
     ENSP00000222553   ENSP00000346242   ENSP00000390591   ENSP00000390896  
    Reactome Protein details: P43490
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Enzo Life Sciences proteins for NAMPT
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    Browse OriGene Protein Over-expression Lysates
    OriGene Custom Protein Services for NAMPT 
    GenScript Custom Purified and Recombinant Proteins Services for NAMPT
    Novus Biologicals NAMPT Proteins
    Browse Sino Biological Recombinant Proteins
    ProSpec Recombinant Protein for NAMPT
    Uscn Proteins for NAMPT

    Gene Ontology (GO): 2 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005737cytoplasm ----
    GO:0005829cytosol TAS--


    NAMPT for ontologies           About GeneDecksing



    NAMPT Antibody Products: 
    EMD Millipore Mono- and Polyclonal Antibodies for the study of NAMPT
    R&D Systems Antibodies for NAMPT (PBEF/Visfatin)
    OriGene Antibodies: NAMPT
    OriGene Custom Antibody Services for NAMPT 
    GenScript Custom Superior Antibodies Services for NAMPT
    Novus Biologicals NAMPT Antibodies
    Abcam antibodies for NAMPT 
    Uscn Antibodies for NAMPT
    ThermoFisher Antibodies for NAMPT

    Assay Products for NAMPT: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for NAMPT
    Enzo Life Sciences assays for NAMPT
    Uscn ELISAs and CLIAs for NAMPT


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    NAMPT for domains           About GeneDecksing

    3 InterPro domains/families:
     IPR002638 Quinolinate_PRibosylTrfase_C
     IPR016471 Nicotinamide_PRibTrfase
     IPR015977 Nic_PRibTrfase-like

    Graphical View of Domain Structure for InterPro Entry P43490

    ProtoNet protein and cluster: P43490

    UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490
    Similarity: Belongs to the NAPRTase family


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490
    Function: Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide
    mononucleotide, an intermediate in the biosynthesis of NAD. It is the rate limiting component in the mammalian NAD
    biosynthesis pathway (By similarity)
    Catalytic activity: Nicotinamide D-ribonucleotide + diphosphate = nicotinamide + 5-phospho-alpha-D-ribose 1-diphosphate
    Enzyme regulation: Inhibited by FK866. FK866 competes for the same binding site as nicotinamide, but due to its very
    low dissociation rate, it is essentially an irreversible inhibitor

    Enzyme Number (IUBMB): EC 2.4.2.121 2

    miRNA
    Products:
        
    miRTarBase miRNAs that target NAMPT:
    hsa-mir-155 (MIRT005102)

    OriGene 3'-UTR Clone: NAMPT
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat NAMPT
    8/83 QIAGEN miScript miRNA Assays for microRNAs that regulate NAMPT (see all 83):
    hsa-miR-607 hsa-miR-300 hsa-miR-200a hsa-miR-578 hsa-miR-3142 hsa-miR-556-3p hsa-miR-374b* hsa-miR-647
    SwitchGear 3'UTR luciferase reporter plasmidNAMPT 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for NAMPT (see all 4)
    OriGene shRNA RFP: NAMPT
    OriGene siRNA: NAMPT
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat NAMPT

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for NAMPT

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for NAMPT (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for NAMPT (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: NAMPT (NM_005746)
    Sino Biological Human cDNA Clone for NAMPT
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for NAMPT
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NAMPT 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for NAMPT
    Search LifeMap BioReagents cell lines for NAMPT

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NAMPT

    Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004514nicotinate-nucleotide diphosphorylase (carboxylating) activity IEA--
    GO:0004516nicotinate phosphoribosyltransferase activity IEA--
    GO:0005125cytokine activity TAS8289818
    GO:0047280nicotinamide phosphoribosyltransferase activity IEA--


    NAMPT for ontologies           About GeneDecksing


    1 GenomeRNAi human phenotype for NAMPT:
     High actin ratio cells 

    Animal Models:
         6 MGI mutant phenotypes (inferred from 2 alleles(MGI details for Nampt):
     cellular  endocrine/exocrine gland  hematopoietic system  homeostasis/metabolism  immune system 
     mortality/aging 

    NAMPT for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/8 super-pathways (see all 8About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1NAD metabolism
    NAD metabolism1.00
    Nicotinate and nicotinamide metabolism0.43
    NAD metabolism1.00
    2Nicotinamide salvaging
    Nicotinamide salvaging1.00
    Expression of NAMPT (NamPRT, PBEF, Visfatin)0.50
    3Nicotinate metabolism
    Nicotinate metabolism1.00
    NAD biosynthesis III0.50
    4Circadian rhythm - mammal
    Circadian Clock0.41
    BMAL1:CLOCK/NPAS2 Activates Circadian Expression0.23
    5Vitamin B5 (pantothenate) metabolism
    Metabolism of vitamins and cofactors0.21
    Metabolism of water-soluble vitamins and cofactors0.21

    Pathway sources
    See GeneCards unified pathways
    Show all pathways

    1 EMD Millipore Pathway for NAMPT
        NAD metabolism

    1 R&D Systems Pathway for NAMPT
        Adipocytokines & Insulin Signaling


    1 GeneGo (Thomson Reuters) Pathway for NAMPT
        NAD metabolism

    2 BioSystems Pathways for NAMPT 
        Adipogenesis
    NAD biosynthesis III

    5/8        Reactome Pathways for NAMPT (see all 8)
        Circadian Clock
    Nicotinamide salvaging
    Metabolism
    Metabolism of vitamins and cofactors
    Nicotinate metabolism


    1         Kegg Pathway  (Kegg details for NAMPT):
        Nicotinate and nicotinamide metabolism

    UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490
    Pathway: Cofactor biosynthesis; NAD(+) biosynthesis; nicotinamide D-ribonucleotide from 5-phospho-alpha-D-ribose
    1-diphosphate and nicotinamide: step 1/1


    NAMPT for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for NAMPT

    STRING Interaction Network Preview (showing 5 interactants - click image to see 11)

    5/19 Interacting proteins for NAMPT (P434902, 3 ENSP000002225534) via UniProtKB, MINT, STRING, and/or I2D (see all 19)

    InteractantInteraction Details
    GeneCardExternal ID(s)
    FTLP027922, 3, ENSP000003665254MINT-6538799 MINT-6538712 MINT-6538862 I2D: score=1 STRING: ENSP00000366525
    MT-ND1P038862, 3, ENSP000003546874MINT-6538787 MINT-6538841 MINT-6538697 I2D: score=1 STRING: ENSP00000354687
    ADORA2AP292742, 3, ENSP000003366304MINT-6538741 I2D: score=1 STRING: ENSP00000336630
    UBE2L6O149332, 3, ENSP000002871564MINT-6538769 I2D: score=1 STRING: ENSP00000287156
    IFITM3Q016282, 3, ENSP000003827074MINT-6538727 MINT-6538811 MINT-6538868 I2D: score=1 STRING: ENSP00000382707
    About this table

    Gene Ontology (GO): 5/13 biological process terms (GO ID links to tree view) (see all 13):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006766vitamin metabolic process TAS--
    GO:0006767water-soluble vitamin metabolic process TAS--
    GO:0006769nicotinamide metabolic process TAS--
    GO:0007165signal transduction TAS8289818
    GO:0007267cell-cell signaling TAS8289818


    NAMPT for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    NAMPT for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Enzo Life Sciences drugs & compounds for NAMPT

    Browse Tocris compounds for NAMPT

    6 HMDB Compounds for NAMPT    About this table
    CompoundSynonyms CAS #PubMed Ids
    NAD3-Carbamoyl-1-D-ribofuranosylpyridinium hydroxide 5'-ester with adenosine 5'-pyrophosphate (see all 28)53-84-9--
    Niacinamide3-Carbamoylpyridine (see all 77)98-92-0--
    Nicotinamide ribotide3-(aminocarbonyl)-1-(5-O-phosphono-b-D-ribofuranosyl)-Pyridinium hydroxide inner salt (see all 15)1094-61-7--
    Phosphoribosyl pyrophosphate5-Phospho-a-D-ribose-1-diphosphate (see all 37)7540-64-9--
    Phosphoric acidacide phosphorique (FRENCH) (see all 20)7664-38-2--
    Pyrophosphate(4-)Diphosphoric acid ion (see all 10)14000-31-8--

    1 DrugBank Compound for NAMPT    About this table
    CompoundSynonyms CAS #TypeActionsPubMed Ids
    N-[4-(1-BENZOYLPIPERIDIN-4-YL)BUTYL]-3-PYRIDIN-3-YLPROPANAMIDE-- --target--10592235

    10/21 Novoseek chemical compound relationships for NAMPT gene (see all 21)    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    fk-866 93.7 17 19936064 (3), 14612543 (2), 18247435 (1), 18768589 (1) (see all 8)
    nicotinamide 87.7 187 19666527 (3), 19149599 (3), 12555668 (3), 19727662 (2) (see all 63)
    nicotinamide mononucleotide 83.4 33 16901503 (2), 18823127 (2), 16783373 (2), 19727662 (1) (see all 10)
    nad+ 72.9 88 17268245 (4), 19855187 (3), 19182797 (3), 19703994 (2) (see all 28)
    glucose 61 168 19302375 (5), 19650786 (5), 19461540 (4), 16736128 (4) (see all 66)
    prpp 52.1 3 17565174 (1), 12555668 (1)
    rosiglitazone 49.5 13 16735449 (4), 18942491 (3), 17235334 (2), 19815243 (2) (see all 6)
    niacin 48.4 5 15837705 (1), 10218108 (1), 2183889 (1)
    pioglitazone 47.3 20 17952841 (4), 17378999 (3), 18031315 (2), 19158194 (2) (see all 5)
    lipid 38.4 32 17429683 (3), 18246224 (2), 19804767 (2), 19815243 (2) (see all 22)

    Search CenterWatch for drugs/clinical trials and news about NAMPT 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for NAMPT gene (2 alternative transcripts): 
    NM_005746.2  NM_182790.1  

    Unigene Cluster for NAMPT:

    Nicotinamide phosphoribosyltransferase
    Hs.489615  [show with all ESTs]
    Unigene Representative Sequence: NM_005746
    13 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000222553(uc003vdq.3 uc003vdr.1 uc011klu.1) ENST00000463871
    ENST00000354289 ENST00000491027 ENST00000467730 ENST00000484527 ENST00000393618
    ENST00000441045 ENST00000486949 ENST00000489358 ENST00000424768 ENST00000489732
    ENST00000417537

    miRNA
    Products:
         
    OriGene 3'-UTR Clone: NAMPT
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat NAMPT
    8/83 QIAGEN miScript miRNA Assays for microRNAs that regulate NAMPT (see all 83):
    hsa-miR-607 hsa-miR-300 hsa-miR-200a hsa-miR-578 hsa-miR-3142 hsa-miR-556-3p hsa-miR-374b* hsa-miR-647
    SwitchGear 3'UTR luciferase reporter plasmidNAMPT 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for NAMPT (see all 4)
    OriGene shRNA RFP: NAMPT
    OriGene siRNA: NAMPT
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat NAMPT
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for NAMPT (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for NAMPT (see all 2)
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: NAMPT (NM_005746)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for NAMPT
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NAMPT 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for NAMPT
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat NAMPT
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat NAMPT
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat NAMPT

    Additional cDNA sequence: 

    AK292851.1 AK304085.1 BC072439.1 BC106046.1 L29050.1 U02020.1 

    24/35 DOTS entries (see all 35):

    DT.100703768  DT.119356  DT.100037990  DT.100883858  DT.121066768  DT.95329224  DT.100662669  DT.86852592 
    DT.100883852  DT.92036344  DT.428653  DT.97802778  DT.121066749  DT.91768071  DT.91974524  DT.92014376 
    DT.95251570  DT.121066780  DT.99961287  DT.100802957  DT.100883849  DT.100883856  DT.121066728  DT.121066757 

    24/691 AceView cDNA sequences (see all 691):

    AI282896 BM471070 BQ786796 CA443907 AA281120 AW272904 BM834402 F02728 
    BF221904 CD559401 AV660602 BU158486 BM975676 BX471085 AA487998 AU279728 
    BQ224320 NM_005746 CB127007 Z40876 AI583587 AA805709 AI307249 BG149699 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    NAMPT expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: GCCTTAACAA

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image

    NAMPT expression in embryonic tissues and stem cells
    Expression by the Database of Embryonic development, Stem cell research, and Regenerative medicine    About this table
    1 LifeMap In Vivo Development Anatomical Compartment/Cell 
    Tissue Anatomical Compartment CellCategory (developmental path)
    KidneyMetanephrosKidney
    Expression: Positive    Negative     Selective marker
    Experimental details: Curated     Microarrays     In-situ hybridization
    Stem Cell Differentiation: 2 LifeMap Cells 
    NameCategory
    Definitive endoderm-like cells (A scalable, suspensi...)
    HyStem+BMP4-induced 7SMOO32 cells (HyStem+BMP4 inductio...)Adipose

    See NAMPT Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for NAMPT

    SOURCE GeneReport for Unigene cluster: Hs.489615

    UniProtKB/Swiss-Prot: NAMPT_HUMAN, P43490
    Tissue specificity: Expressed in large amounts in bone marrow, liver tissue, and muscle. Also present in heart,
    placenta, lung, and kidney tissues

        SABiosciences Expression via Pathway-Focused PCR Arrays including NAMPT (see all 6): 
              Notch Signaling Targets in human mouse rat
              Insulin Resistance in human mouse rat
              Inflammatory Cytokines & Receptors in human mouse rat
              Common Cytokines in human mouse rat
              Hypoxia Signaling Pathway in human mouse rat

    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for NAMPT
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat NAMPT
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat NAMPT
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat NAMPT
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NAMPT

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of chordates.

    Orthologs for NAMPT gene from 4/16 species (see all 16)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    chicken
    (Gallus gallus)
    Aves NAMPT1 nicotinamide phosphoribosyltransferase 84.43(n)
    94.47(a)
      417707  NM_001030728.1  NP_001025899.1 
    lizard
    (Anolis carolinensis)
    Reptilia --
    --
    90(a)
    1 → many
    5(96943891-96975374)
    African clawed frog
    (Xenopus laevis)
    Amphibia LOC3985022 similar to pre-B-cell colony-enhancing factor 79.45(n)    BC045090.1 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.86942 Danio rerio mRNA similar to pre-B-cell colony-enhancing more 71.5(n)    BC044476.1 


    ENSEMBL Gene Tree for NAMPT (if available)
    TreeFam Gene Tree for NAMPT (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for NAMPT gene
    NAMPTL2  
    1 SIMAP similar gene for NAMPT using alignment to 3 protein entries:     NAMPT_HUMAN (see all proteins):
    NAMPTL

    NAMPT for paralogs           About GeneDecksing


    2 Pseudogenes.org Pseudogenes for NAMPT
    PGOHUM00000258464 PGOHUM00000235414


    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/638 NCBI SNPs in NAMPT are shown (see all 638    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 7 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1175538871,2
    --105888295(+) CAATAC/GAGTTA 1 -- ds50011Minor allele frequency- G:0.01NA 120
    rs1434769901,2
    --105888340(+) ATGGCA/GTGGGG 1 -- ds50010--------
    rs1893456151,2
    --105888342(+) GGCGTC/GGGGTT 1 -- ds50010--------
    rs1808920651,2
    --105888530(+) TAACAC/TGGGAA 1 -- ds50010--------
    rs1863865701,2
    --105888537(+) GGAATC/TGTGCT 1 -- ds50010--------
    rs1464549781,2
    --105888593(+) AAGGCA/CCTGTC 1 -- ds50010--------
    rs1908356661,2
    --105888604(+) ATCTAC/TACAGT 1 -- ds50010--------
    rs1815944941,2
    --105888605(+) TCTATA/TCAGTT 1 -- ds50010--------
    rs758201771,2
    C--105888627(+) AAAAGG/TAGTCA 1 -- ds50010--------
    rs1413356431,2
    --105888641(+) CTGACA/TCTTGC 1 -- ds50010--------

    HapMap Linkage Disequilibrium report for NAMPT (105888731 - 105926772 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for NAMPT: --
    Human Gene Mutation Database (HGMD): NAMPT

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing NAMPT
    DNA2.0 Custom Variant and Variant Library Synthesis for NAMPT

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    NAMPT for disorders           About GeneDecksing

    OMIM gene information: 608764    OMIM disorders: --

    20/67 diseases for NAMPT (see all 67):    About MalaCards
    retinol binding protein    polycystic ovary syndrome    pre-eclampsia    type 2 diabetes mellitus
    type 1 diabetes mellitus    diabetes mellitus    bulimia nervosa    chronic obstructive pulmonary disease
    sleep apnea    insulin resistance    metabolic disorders    pyelonephritis
    fatty liver disease    acute pyelonephritis    coronary heart disease    inflammatory bowel disease
    morbid obesity    rheumatoid arthritis    gestational diabetes    ascariasis

    3 diseases from the University of Copenhagen DISEASES database for NAMPT:
    Diabetes mellitus     Atherosclerosis     Polycystic ovary syndrome

    10/26 Novoseek disease relationships for NAMPT gene (see all 26)    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    insulin resistance 80.8 108 17634078 (4), 16720654 (4), 20346233 (3), 19222486 (3) (see all 58)
    obesity 74.3 125 20346233 (5), 17512309 (3), 17878256 (3), 19444230 (3) (see all 53)
    insulin sensitivity 68.2 30 17327330 (3), 20151765 (3), 17586594 (2), 18803942 (2) (see all 20)
    inflammation 60.5 83 18248642 (4), 20470278 (4), 20346239 (3), 17634078 (3) (see all 42)
    polycystic ovary syndrome 54 2 18848173 (1), 19111298 (1)
    niddm 51.8 21 18691043 (2), 18246224 (1), 16401830 (1), 18686225 (1) (see all 12)
    atherosclerosis 50 16 19351806 (2), 19178507 (2), 18663287 (1), 20145358 (1) (see all 12)
    cardiovascular diseases 48.7 8 15968578 (1), 16311222 (1), 17970534 (1), 16391616 (1) (see all 8)
    diabetes gestational 48 12 16489932 (2), 18787378 (2), 16814166 (1), 17416788 (1) (see all 8)
    necrosis 43.5 33 17283255 (2), 18272217 (1), 17882804 (1), 17878891 (1) (see all 29)

    Human Genome Epidemiology (HuGE) Navigator: NAMPT (2 documents)

    Export disorders for NAMPT gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for NAMPT gene, integrated from 9 sources (see all 477):
    (articles sorted by number of sources associating them with NAMPT)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Cloning and characterization of the cDNA encoding a novel human pre- B-cell colony-enhancing factor. (PubMed id 8289818)1, 2, 3, 9 Samal B.... McNiece I. (1994)
    2. Molecular basis for the inhibition of human NMPRTase, a novel target for anticancer agents. (PubMed id 16783377)1, 2, 9 Khan J.A.... Tong L. (2006)
    3. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PubMed id 14702039)1, 2 Ota T.... Sugano S. (2004)
    4. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). (PubMed id 15489334)1, 2 Gerhard D.S....Malek J. (2004)
    5. The DNA sequence of human chromosome 7. (PubMed id 12853948)1, 2 Hillier L.W.... Wilson R.K. (2003)
    6. Human chromosome 7: DNA sequence and biology. (PubMed id 12690205)1, 2 Scherer S.W.... Tsui L.-C. (2003)
    7. Extracellular PBEF/NAMPT/visfatin activates pro-infla mmatory signalling in human vascular smooth muscle cells through nicotinamide p hosphoribosyltransferase activity. (PubMed id 19727662)1, 9 Romacho T....PeirA^ C. (2009)
    8. Regulation of pre-B cell colony-enhancing factor by STAT-3-dependent interleukin-6 trans-signaling: implications in the pathogenesis of rheumatoid arthritis. (PubMed id 16802343)1, 9 Nowell M.A....Jones S.A. (2006)
    9. Pre-B-cell colony-enhancing factor is a secreted cytokine-like protein from the human amniotic epithelium. (PubMed id 16021090)1, 9 Ognjanovic S....Bryant-Greenwood G.D. (2005)
    10. Visfatin is increased in chronic kidney disease patie nts with poor appetite and correlates negatively with fasting serum amino acids and triglyceride levels. (PubMed id 19948877)1, 9 Carrero J.J....Axelsson J. (2010)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 10135 HGNC: 30092 AceView: PBEF1 Ensembl:ENSG00000105835 euGenes: HUgn10135
    ECgene: NAMPT Kegg: 10135 H-InvDB: NAMPT

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for NAMPT Pharmacogenomics, SNPs, Pathways

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for NAMPT gene:
    Search GeneIP for patents involving NAMPT

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     Browse Small Molecules at EMD Millipore
     EMD Millipore Mono- and Polyclonal Antibodies for the study of NAMPT
     Browse Purified and Recombinant Proteins at EMD Millipore
     Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
     Browse for Gene Knock-down Tools from EMD Millipore
     Browse Kits and Assays available from EMD Millipore
     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Antibodies for NAMPT (PBEF/Visfatin)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     OriGene Antibodies for NAMPT   OriGene shRNA RFP for NAMPT  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for NAMPT   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for NAMPT  
     Browse OriGene Protein Over-expression Lysates   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for NAMPT   OriGene 3'-UTR Clone for NAMPT  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for NAMPT   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for NAMPT  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for NAMPT   OriGene Custom Protein Services for NAMPT  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat NAMPT
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing NAMPT
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat NAMPT
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat NAMPT
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat NAMPT
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat NAMPT
     GenScript Custom Purified and Recombinant Proteins Services for NAMPT GenScript cDNA clones with any tag delivered in your preferred vector for NAMPT
     GenScript Custom Assay Services for NAMPT GenScript Custom Superior Antibodies Services for NAMPT
     GenScript Custom overexpressing Cell Line Services for NAMPT CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in NAMPT promoter
     Search Chromatin IP Primers for NAMPT
     RT2 qPCR Primer Assay in human, mouse, rat NAMPT
     GNC Network for NAMPT
     SABiosciences PCR Arrays including human, mouse, rat NAMPT
     Search Tocris compounds for NAMPT
     Browse Sino Biological Proteins and Antibodies
     cDNA Clones for NAMPT
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Assays/Drugs/Proteins for NAMPT
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     NAMPT antibodies
     NAMPT proteins
     Antibodies for NAMPT
     See all of Abcam's Antibodies, Kits and Proteins for NAMPT
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Recombinant Protein for NAMPT




     NAMPT Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for NAMPT
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for NAMPT
     SwitchGear 3'UTR luciferase reporter plasmids for NAMPT
     SwitchGear Promoter luciferase reporter plasmids for NAMPT
     ThermoFisher Antibodies for NAMPT
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat NAMPT
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      NAMPT gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 100 solr: 1.4