Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

MUT Gene

protein-coding   GIFtS: 66
GCID: GC06M049445

methylmalonyl CoA mutase

(Previous name: methylmalonyl Coenzyme A mutase )
 Explore 23 diseases affiliated with
MUT via our new
 Human Malady Compendium 
Biological research products
for MUT
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Methylmalonyl CoA Mutase1 2
MCM2 3 5
Methylmalonyl Coenzyme A Mutase1 2
Methylmalonyl-CoA Isomerase2 3
EC 5.4.99.23 8
Methylmalonyl-CoA Mutase, Mitochondrial2

External Ids:    HGNC: 75261   Entrez Gene: 45942   Ensembl: ENSG000001460857   OMIM: 6090585   UniProtKB: P220333   

Export aliases for MUT gene to outside databases

Previous GC identifers: GC06M049401 GC06M049506 GC06M049126


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for MUT:
This gene encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a
vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other
species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic
aciduria. (provided by RefSeq, Jul 2008)

UniProtKB/Swiss-Prot: MUTA_HUMAN, P22033
Function: Involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA
to the tricarboxylic acid cycle. MCM has different functions in other species

Gene Wiki entry for MUT (Methylmalonyl-CoA mutase)


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000006.11  NC_018917.1  NT_007592.15  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the MUT gene promoter:
         SRF   SRF (504 AA)   CUTL1   E47   MEF-2A   FAC1   Cart-1   Hand1   aMEF-2   MRF-2   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidMUT promoter sequence
   Search SABiosciences Chromatin IP Primers for MUT

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat MUT


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 6p12.3   Ensembl cytogenetic band:  6p12.3   HGNC cytogenetic band: 6p21

MUT Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
MUT gene location

GeneLoc information about chromosome 6         GeneLoc Exon Structure

GeneLoc location for GC06M049445:  view genomic region     (about GC identifiers)

Start:
49,398,073 bp from pter      End:
49,431,041 bp from pter
Size:
32,969 bases      Orientation:
minus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: MUTA_HUMAN, P22033 (See protein sequence)
Recommended Name: Methylmalonyl-CoA mutase, mitochondrial precursor  
Size: 750 amino acids; 83134 Da
Cofactor: Adenosylcobalamin
Subunit: Homodimer
Subcellular location: Mitochondrion matrix
3 PDB 3D structures from and Proteopedia for MUT:
2XIJ (3D)        2XIQ (3D)        3BIC (3D)    
Secondary accessions: A8K953 Q5SYZ3 Q96B11 Q9UD64

Explore the universe of human proteins at neXtProt for MUT: NX_P22033

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_P22033

  • 34 DME Specific Peptides for MUT (P22033) (see first 4)
     TQSLHTN  WHTPEGI  LFLLSPH  MEIAKMRA 
     RQYAGFST  GLSVAFDL  TVGEITDA  RGPYPTMY 
     THRGYDSD  VIVGVNKY  VSMTMNGAV  KFMEREGRR 
     SARIARNTQ  GDVGMAGVA  FAPRLSFFW  AQQAVDADVH 
     AKMGQDGHDRG  VLAIDNTSVRN  QTSGWSLTEQDP  DIEKCLEKKQQS 
     ISISGYHMQEAG  MPKFNSISISGYH  AVDADVHAVGVST  AAVQVLDDIEKCL 
     CAASGDGNILALAV  AAGHKTLVPELIKEL  EVGVSNVFGPGTRIP  GTIQNDILKEFMVRNTYI 
     NSFDEALGLPTVKSARIARNT  LGRPDILVMCGGVIPPQDYEFL  QRLLHQQQPLHPEWAALAKKQLKGKNPE  KKVFGEHKANDRMVSGAYRQEFGESKEI 
     DGHDRGAKVIATGFADLGFDVDIGPLFQTPREVA  EEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVG 

    MUT Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins: NP_000246.2  
    ENSEMBL proteins: 
     ENSP00000274813  
    Reactome Protein details: P22033
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    Browse R&D Systems for human recombinant proteins
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    OriGene Protein Over-expression Lysate: MUT
    OriGene Custom Protein Services for MUT 
    GenScript Custom Purified and Recombinant Proteins Services for MUT
    Novus Biologicals MUT Proteins
    Novus Biologicals MUT Lysates
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for MUT

    Gene Ontology (GO): 2 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0005739mitochondrion TAS2567699
    GO:0005759mitochondrial matrix TAS--


    MUT for ontologies           About GeneDecksing



    MUT Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    Browse R&D Systems for Antibodies
    OriGene Antibodies (see all 2): MUT
    OriGene Custom Antibody Services for MUT 
    GenScript Superior Antibodies for MUT
    Novus Biologicals MUT Antibodies
    Abcam antibodies for MUT 
    Uscn Antibodies for MUT
    Search ThermoFisher Antibodies for MUT

    Assay Products for MUT: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for MUT
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for MUT


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    MUT for domains           About GeneDecksing

    5/6 InterPro domains/families (see all 6):
     IPR006098 MMCoA_mutase_a_cat
     IPR014348 Cbl-dep_enz_cat-sub
     IPR006099 MeMalonylCoA_mutase_a/b_cat
     IPR006159 Acid_CoA_mut_C
     IPR016176 Cbl-dep_enz_cat

    Graphical View of Domain Structure for InterPro Entry P22033

    ProtoNet protein and cluster: P22033

    2 Blocks protein families:
    IPB006099 Methylmalonyl-CoA mutase
    IPB006158 Coenzyme B12-binding


    UniProtKB/Swiss-Prot: MUTA_HUMAN, P22033
    Similarity: Belongs to the methylmalonyl-CoA mutase family
    Similarity: Contains 1 B12-binding domain


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: MUTA_HUMAN, P22033
    Function: Involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA
    to the tricarboxylic acid cycle. MCM has different functions in other species
    Catalytic activity: (R)-methylmalonyl-CoA = succinyl-CoA

         Genatlas biochemistry entry for MUT:
    methylmalonyl-CoA mutase

    Enzyme Number (IUBMB): EC 5.4.99.21 2

    miRNA
    Products:
        
    OriGene 3'-UTR Clone: MUT
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat MUT
    8/16 QIAGEN miScript miRNA Assays for microRNAs that regulate MUT (see all 16):
    hsa-miR-548w hsa-miR-548j hsa-miR-320a hsa-miR-559 hsa-miR-548i hsa-miR-548h hsa-miR-548c-5p hsa-miR-548k
    SwitchGear 3'UTR luciferase reporter plasmidMUT 3' UTR sequence
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for MUT (see all 4)
    OriGene shRNA RFP: MUT
    OriGene siRNA: MUT
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat MUT

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for MUT

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for MUT (see all 2)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for MUT
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: MUT (NM_000255)
    Browse Sino Biological Human cDNA Clones
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for MUT
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat MUT 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for MUT
    Search LifeMap BioReagents cell lines for MUT

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for MUT

    Gene Ontology (GO): 4 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0004494methylmalonyl-CoA mutase activity TAS--
    GO:0031419cobalamin binding IEA--
    GO:0046872metal ion binding IEA--
    GO:0072341modified amino acid binding IDA--


    MUT for ontologies           About GeneDecksing


    3 GenomeRNAi human phenotypes for MUT:
     Increased gamma-H2AX phosphory  Synthetic lethal with Ras  Upregulation of Wnt/beta-caten 

    Animal Models:
         Mouse knock-outs for MUT: Muttm1Pai Muttm1Cpv
         14 MGI mutant phenotypes (inferred from 2 alleles(MGI details for Mut):
     behavior/neurological  cardiovascular system  cellular  digestive/alimentary  endocrine/exocrine gland 
     growth/size  homeostasis/metabolism  immune system  liver/biliary system  mortality/aging 
     nervous system  other  renal/urinary system  respiratory system 

    MUT for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways - 5/8 super-pathways (see all 8About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Metabolism
    Metabolism1.00
    Metabolism of lipids and lipoproteins0.34
    Metabolic pathways0.38
    2Propionyl-CoA catabolism
    Propionyl-CoA catabolism1.00
    methylmalonyl pathway0.60
    3Branched-chain amino acid catabolism
    Valine, leucine and isoleucine degradation0.39
    Propanoate metabolism0.07
    4Glyoxylate and dicarboxylate metabolism
    Glyoxylate and dicarboxylate metabolism1.00
    52-oxoisovalerate decarboxylation to isobutanoyl-CoA
    2-oxobutanoate degradation I0.57

    Pathway sources
    See GeneCards unified pathways
    Show all pathways


    3 BioSystems Pathways for MUT 
        methylmalonyl pathway
    2-oxobutanoate degradation I
    superpathway of methionine degradation

    5        Reactome Pathways for MUT
        Propionyl-CoA catabolism
    Metabolism
    Fatty acid, triacylglycerol, and ketone body metabolism
    Metabolism of lipids and lipoproteins
    Mitochondrial Fatty Acid Beta-Oxidation


    4         Kegg Pathways  (Kegg details for MUT):
        Valine, leucine and isoleucine degradation
    Glyoxylate and dicarboxylate metabolism
    Propanoate metabolism
    Metabolic pathways


    MUT for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for MUT

    STRING Interaction Network Preview (showing 5 interactants - click image to see 14)

    5/244 Interacting proteins for MUT (P220332, 3 ENSP000002748134) via UniProtKB, MINT, STRING, and/or I2D (see all 244)
    InteractantInteraction Details
    GeneCardExternal ID(s)
    ICT1Q141972, 3, ENSP000003015854MINT-8079030 I2D: score=1 STRING: ENSP00000301585
    MMAAQ8IVH43, ENSP000002813174I2D: score=1 STRING: ENSP00000281317
    SUCLA2Q9P2R72, ENSP000003679234MINT-8079030 STRING: ENSP00000367923
    C12orf44Q9BSB43I2D: score=1 
    PCBD1P614573I2D: score=1 
    About this table

    Gene Ontology (GO): 5/6 biological process terms (GO ID links to tree view) (see all 6):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006635fatty acid beta-oxidation TAS--
    GO:0009791post-embryonic development IEA--
    GO:0019626short-chain fatty acid catabolic process TAS--
    GO:0044255cellular lipid metabolic process TAS--
    GO:0044281small molecule metabolic process TAS--


    MUT for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    MUT for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for MUT

    6 HMDB Compounds for MUT    About this table
    CompoundSynonyms CAS #PubMed Ids
    Adenosylcobalamin(5'-Deoxy-5'-adenosyl)cobamide coenzyme (see all 15)13870-90-1--
    Cobalamin5,6-dimethyl-1-a-D-ribofuranosylbenzimidazole (see all 15)13408-78-1--
    CobaltCo (see all 6)7440-48-4--
    CyanocobalaminDimethylbenzimidazoylcobamide (see all 92)68-19-9--
    R-Methylmalonyl-CoA 73173-92-9--
    Succinyl-CoACoenzyme A S-(hydrogen succinate) (see all 24)604-98-8--

    2 DrugBank Compounds for MUT    About this table
    CompoundSynonyms CAS #TypeActionsPubMed Ids
    HydroxocobalaminHydroxomin (see all 2)13422-51-0targetcofactor36882 7599160 11955068 11752352 18565 8741039
    CyanocobalaminCyanocob(III)alamin (see all 3)68-19-9targetcofactor19904199 17011224 16281286 16813422 16305240

    10/16 Novoseek chemical compound relationships for MUT gene (see all 16)    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    adenosylcobalamin 94.5 30 10377254 (2), 9285782 (2), 9554742 (1), 17410422 (1) (see all 18)
    l-methylmalonyl-coa 91.1 7 1979711 (2), 1970332 (1), 9285782 (1), 16823967 (1)
    cobalamin 79.6 16 10377254 (2), 9242908 (1), 16150626 (1), 17075691 (1) (see all 10)
    methylmalonic acid 79.4 3 8929440 (2), 8017644 (1)
    methylcobalamin 64.9 3 10377254 (1), 16150626 (1)
    vitamin b12 64.5 6 9554742 (1), 18375549 (1), 16150626 (1), 20174775 (1) (see all 5)
    propionate 60.2 10 1363155 (4), 10518277 (1), 8929440 (1), 19699272 (1)
    methionine 41.9 7 9242908 (1), 10377254 (1), 16150626 (1), 20174775 (1) (see all 7)
    carnitine 38.3 1 1363155 (1)
    cobalt 35.8 2 9242908 (2)

    Search CenterWatch for drugs/clinical trials and news about MUT / MUTA 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for MUT gene: 
    NM_000255.3  

    Unigene Cluster for MUT:

    Methylmalonyl CoA mutase
    Hs.485527  [show with all ESTs]
    Unigene Representative Sequence: NM_000255
    1 Ensembl transcript including schematic representation, and UCSC links where relevant:
    ENST00000274813(uc003ozg.4)

    miRNA
    Products:
         
    OriGene 3'-UTR Clone: MUT
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat MUT
    8/16 QIAGEN miScript miRNA Assays for microRNAs that regulate MUT (see all 16):
    hsa-miR-548w hsa-miR-548j hsa-miR-320a hsa-miR-559 hsa-miR-548i hsa-miR-548h hsa-miR-548c-5p hsa-miR-548k
    SwitchGear 3'UTR luciferase reporter plasmidMUT 3' UTR sequence
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for MUT (see all 4)
    OriGene shRNA RFP: MUT
    OriGene siRNA: MUT
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat MUT
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for MUT (see all 2)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for MUT
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: MUT (NM_000255)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for MUT
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat MUT 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for MUT
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat MUT
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat MUT
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat MUT

    Additional cDNA sequence: 

    AK292568.1 AK312611.1 BC016282.1 BT007434.1 M65131.1 

    7 DOTS entries:

    DT.452288  DT.95275002  DT.102828174  DT.92440605  DT.92440604  DT.40309424  DT.100814317 

    24/286 AceView cDNA sequences (see all 286):

    AA232575 BU616598 BQ953836 AV652668 AV654874 CA391153 AU143086 AL524144 
    AA232707 AI795914 BI766242 BG428937 AV647421 AA761038 AU103579 AI022429 
    AV647666 AL702891 BU609220 AI241116 AV651416 AV652036 BF196499 CA419536 

    GeneLoc Exon Structure

    4 Alternative Splicing Database (ASD) splice patterns (SP) for MUT    About this scheme

    ExUns: 1a · 1b · 1c · 1d ^ 2 ^ 3a · 3b ^ 4 ^ 5 ^ 6a · 6b ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13
    SP1:                                                        -                                                   
    SP2:                                                                                                            
    SP3:                    -                                                                                       
    SP4:                    -                                                                                       


    ECgene alternative splicing isoforms for MUT

    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    MUT expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: GTGATGTATT

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image
    See MUT Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for MUT

    SOURCE GeneReport for Unigene cluster: Hs.485527
        SABiosciences Expression via Pathway-Focused PCR Arrays including MUT: 
              Fatty Acid Metabolism in human mouse rat
              Amino Acid Metabolism II in human mouse rat

    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for MUT
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat MUT
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat MUT
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat MUT
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for MUT

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the last universal common ancestor (LUCA).

    Orthologs for MUT gene from 7/23 species (see all 23)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    mouse
    (Mus musculus)
    Mammalia Mut1 , 5 methylmalonyl-Coenzyme A mutase1, 5 88.99(n)1
    95.05(a)1
      17 (19.55 cM)5
    178501  NM_008650.31  NP_032676.21 
     409346855 
    chicken
    (Gallus gallus)
    Aves MUT1 methylmalonyl CoA mutase 79.38(n)
    87.42(a)
      422049  XM_420055.3  XP_420055.1 
    lizard
    (Anolis carolinensis)
    Reptilia MUT6
    --
    87(a)
    1 ↔ 1
    1(139478969-139500413)
    African clawed frog
    (Xenopus laevis)
    Amphibia Xl.48912 Xenopus laevis transcribed sequence with moderate similarity more 78.09(n)    AW644910.1 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.70552 Transcribed sequence with moderate similarity to protein more 77.18(n)    CK027470.1 
    worm
    (Caenorhabditis elegans)
    Secernentea ZK1058.13
    mmcm-11
    Methylmalonyl-coA mutase3
    Protein MMCM-11
    69(a)3
    66.39(n)1
    70.8(a)1
      III(3975202-3979463)3
    1755031  NM_065385.51  NP_497786.21 
    E. coli
    (Escherichia coli)
    Gamma proteobacteria scpA6
    methylmalonyl-CoA mutase
    59(a)
    1 ↔ 1
    Chromosome(3058872-3061016)


    ENSEMBL Gene Tree for MUT (if available)
    TreeFam Gene Tree for MUT (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
      --

    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/559 NCBI SNPs in MUT are shown (see all 559    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 6 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs1219182511,2
    C,pathogenic65379971(-) CACACA/GTGGAC 2 H R mis10--------
    rs1219182571,2
    C,pathogenic65380015(-) CCATCC/TGCCAG 2 R C mis10--------
    rs1219182561,2
    Cpathogenic65381371(-) TCCAAA/TATGAT 2 N Y mis11Minor allele frequency- T:0.00EU 1317
    rs1219182521,2
    Cpathogenic65407329(-) AGTTGG/TTGTTT 2 G V mis11Minor allele frequency- T:0.00NA 4548
    rs360678481,2
    C,--49126884(+) ACACA-/ACCACAC 1 -- ds50010--------
    rs1113227121,2
    --49127804(+) CATATC/TCCAAC 1 -- ut311Minor allele frequency- T:0.50CSA 2
    rs1130259871,2
    C,--49128261(+) AAGTAC/TAAATC 1 -- ut311Minor allele frequency- T:0.50CSA 2
    rs143411,2
    C--49128332(-) GTCTAA/GAATAT 1 -- ut311Minor allele frequency- G:0.00MN 184
    rs768215111,2
    F,--49129325(+) CTTTTT/CAGTTT 1 -- int11Minor allele frequency- C:0.09WA 118
    rs94634811,2
    --49130049(+) TTTGTG/TAGGGG 1 -- int10--------

    HapMap Linkage Disequilibrium report for MUT (49398073 - 49431041 bp)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for MUT: --
    Human Gene Mutation Database (HGMD): MUT

    Locus Specific Mutation Databases (LSDB): MUT

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing MUT
    DNA2.0 Custom Variant and Variant Library Synthesis for MUT

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    MUT for disorders           About GeneDecksing

    OMIM gene information: 609058   
    OMIM disorders: 251000  
    UniProtKB/Swiss-Prot: MUTA_HUMAN, P22033
  • Defects in MUT are the cause of methylmalonic aciduria type mut (MMAM) [MIM:251000]. MMAM is an often fatal
  • disorder of organic acid metabolism. Common clinical features include lethargy, vomiting, failure to thrive,
    hypotonia, neurological deficit and early death. Two forms of the disease are distinguished by the presence (mut-) or
    absence (mut0) of residual enzyme activity. Mut0 patients have more severe neurological manifestations of the disease
    than do MUT- patients. MMAM is unresponsive to vitamin B12 therapy

    20/23 diseases for MUT (see all 23):    About MalaCards
    methylmalonic aciduria, mut(0) type    methylmalonyl-coenzyme a mutase deficiency    methylmalonic aciduria and homocystinuria    neural tube defect
    propionic acidemia    methylmalonic acidemia    megaloblastic anemia    homocystinuria
    cblf    metabolic disorders    cytomegalovirus infection    hepatitis c
    hypotonia    anemia    homocysteine    prostate cancer
    ischemia    hepatitis    cerebritis    cholesterol

    2 diseases from the University of Copenhagen DISEASES database for MUT:
    Methylmalonic acidemia     Hepatitis C

    3 Novoseek disease relationships for MUT gene    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    methylmalonic aciduria 97.1 43 12402345 (2), 19199343 (2), 19806564 (2), 16281286 (2) (see all 30)
    metabolic disorder 27.7 3 16823967 (1), 18052792 (1), 7833369 (1)
    acidosis 24.7 2 7833369 (1)

    Genatlas disease: MUT
    hyperglycinemia,ketotic methylmalonic acidemia

    GeneTests: MUT
    Methylmalonic Acidemia

    Genetic Association Database (GAD): MUT
    Human Genome Epidemiology (HuGE) Navigator: MUT (24 documents)

    Export disorders for MUT gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for MUT gene, integrated from 9 sources (see all 149):
    (articles sorted by number of sources associating them with MUT)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. Spectrum of mutations in mut methylmalonic acidemia and identification of a common Hispanic mutation and haplotype. (PubMed id 16281286)1, 2, 7, 9 Worgan L.C.... Rosenblatt D.S. (2006)
    2. Genetic analysis of three genes causing isolated methylmalonic acidemia: identification of 21 novel allelic variants. (PubMed id 15781192)1, 2, 9 Martinez M.A....Perez B. (2005)
    3. Fine mapping of the autosomal recessive polycystic ki dney disease locus (PKHD1) and the genes MUT, RDS, CSNK2 beta, and GSTA1 at 6p2 1.1-p12. (PubMed id 9503014)1, 3, 9 MA1cher G....Zerres K. (1998)
    4. Cloning and expression of a mutant methylmalonyl coenzyme A mutase with altered cobalamin affinity that causes mut- methylmalonic aciduria. (PubMed id 1346616)1, 2, 9 Crane A.M.... Ledley F.D. (1992)
    5. Structure of the human methylmalonyl-CoA mutase (MUT) locus. (PubMed id 1980486)1, 2, 9 Nham S.U.... Ledley F.D. (1990)
    6. Molecular basis of methylmalonyl-CoA mutase apoenzyme defect in 40 European patients affected by mut(o) and mut- forms of methylmalonic acidemia: identification of 29 novel mutations in the MUT gene. (PubMed id 15643616)1, 2, 9 Acquaviva C.... Elion J. (2005)
    7. Mutation analysis of the MCM gene in Israeli patients with mut(0) disease. (PubMed id 11350191)1, 2, 9 Berger I.... Elpeleg O.N. (2001)
    8. mut0 methylmalonic acidemia: eleven novel mutations of the methylmalonyl CoA mutase including a deletion-insertion mutation. (PubMed id 10923046)1, 2, 9 Fuchshuber A.... Hildebrandt F. (2000)
    9. Expression and kinetic characterization of methylmalonyl-CoA mutase from patients with the mut- phenotype: evidence for naturally occurring interallelic complementation. (PubMed id 9285782)1, 2, 9 Janata J.... Fenton W.A. (1997)
    10. Clustering of mutations in methylmalonyl CoA mutase associated with mut-methylmalonic acidemia. (PubMed id 7912889)1, 2, 9 Crane A.M. and Ledley F.D. (1994)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 4594 HGNC: 7526 AceView: MUT Ensembl:ENSG00000146085 euGenes: HUgn4594
    ECgene: MUT Kegg: 4594 H-InvDB: MUT

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for MUT Pharmacogenomics, SNPs, Pathways
    GeneReviewshttp://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/MUT
    Wikipedia http://en.wikipedia.org/wiki/Methylmalonyl_Coenzyme_A_mutase

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for MUT gene:
    Search GeneIP for patents involving MUT

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Browse Antibodies   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Browse Recombinant/Natural Proteins  
     OriGene Antibodies for MUT   OriGene shRNA RFP for MUT  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for MUT   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for MUT  
     OriGene Protein Over-expression Lysate for MUT   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for MUT   OriGene 3'-UTR Clone for MUT  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for MUT   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for MUT  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for MUT   OriGene Custom Protein Services for MUT  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat MUT
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing MUT
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat MUT
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat MUT
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat MUT
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat MUT
     GenScript Custom Purified and Recombinant Proteins Services for MUT GenScript cDNA clones with any tag delivered in your preferred vector for MUT
     GenScript Custom Assay Services for MUT GenScript Superior Antibodies for MUT
     GenScript Custom overexpressing Cell Line Services for MUT CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in MUT promoter
     Search Chromatin IP Primers for MUT
     RT2 qPCR Primer Assay in human, mouse, rat MUT
     GNC Network for MUT
     SABiosciences PCR Arrays including human, mouse, rat MUT
     Search Tocris compounds for MUT
     Browse Sino Biological Proteins and Antibodies
     Browse Sino Biological cDNA Clones
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     MUT antibodies
     MUT proteins
     MUT lysates
     Antibodies for MUT
     See all of Abcam's Antibodies, Kits and Proteins for MUT
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     MUT Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for MUT
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for MUT
     SwitchGear 3'UTR luciferase reporter plasmids for MUT
     SwitchGear Promoter luciferase reporter plasmids for MUT
     Search ThermoFisher Antibodies for MUT
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat MUT
           
    GeneCards Homepage - Last full update: 18 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      MUT gene at Home site.
    hostname: 356980-web2.xennexinc.com index build: 100 solr: 1.4