Aliases for MUT Gene
Aliases for MUT Gene
External Ids for MUT Gene
- HGNC: 7526
- Entrez Gene: 4594
- Ensembl: ENSG00000146085
- OMIM: 609058
- UniProtKB: P22033
Previous GeneCards Identifiers for MUT Gene
- GC06M049401
- GC06M049445
- GC06M049126
Summaries for MUT Gene
-
This gene encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic aciduria. [provided by RefSeq, Jul 2008]
GeneCards Summary for MUT Gene
MUT (Methylmalonyl-CoA Mutase) is a Protein Coding gene. Diseases associated with MUT include Methylmalonic Aciduria, Mut(0) Type and Methylmalonic Acidemia. Among its related pathways are Diseases of metabolism and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). GO annotations related to this gene include isomerase activity and modified amino acid binding.
UniProtKB/Swiss-Prot for MUT Gene
-
Involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle. MCM has different functions in other species.
No data available for Tocris Summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MUT Gene
Genomics for MUT Gene
Regulatory Elements for MUT Gene
Enhancers for MUT Gene
| GeneHancer Identifier | Score | Enhancer Sources | TSS distance (kb) | Number of Genes Away | Size (kb) | Transcription Factor Binding Sites within enhancer | Other Gene Targets for Enhancer |
|---|
Enhancers around MUT on UCSC Golden Path with GeneCards custom track
Promoters for MUT Gene
| Ensembl Regulatory Elements (ENSRs) | TSS Distance (bp) | Size (bp) | Binding Sites for Transcription Factors within promoters |
|---|
ENSRs around MUT on UCSC Golden Path with GeneCards custom track
- Transcription factor binding sites by QIAGEN in the MUT gene promoter:
Regulatory Element Products
Genomic Location for MUT Gene
- Chromosome:
- 6
- Start:
- 49,430,360 bp from pter
- End:
- 49,463,328 bp from pter
- Size:
- 32,969 bases
- Orientation:
- Minus strand
Genomic View for MUT Gene
Genes around MUT on UCSC Golden Path with GeneCards custom track
- Cytogenetic band:
-
- 6p12.3 by Ensembl
- 6p12.3 by Entrez Gene
- 6p21 by HGNC
MUT Gene in genomic location: bands according to
Ensembl, locations according to GeneLoc
(and/or Entrez Gene and/or Ensembl if different)
Genomic Neighborhood
• Exon Structure
• Gene Density
RefSeq DNA sequence for MUT Gene
Proteins for MUT Gene
-
Protein details for MUT Gene (UniProtKB/Swiss-Prot)
- Protein Symbol:
- P22033-MUTA_HUMAN
- Recommended name:
- Methylmalonyl-CoA mutase, mitochondrial
- Protein Accession:
- P22033
- A8K953
- Q5SYZ3
- Q96B11
- Q9UD64
Protein attributes for MUT Gene
- Size:
- 750 amino acids
- Molecular mass:
- 83134 Da
- Cofactor:
- Name=adenosylcob(III)alamin; Xref=ChEBI:CHEBI:18408;
- Quaternary structure:
-
- Homodimer.
Protein Expression for MUT Gene
Selected DME Specific Peptides for MUT Gene
- P22033:
-
- EEMGGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIVG
- DGHDRGAKVIATGFADLGFDVDIGPLFQTPREVA
- RQYAGFST
- CAASGDGNILALAV
- MPKFNSISISGYH
- QTSGWSLTEQDP
- DIEKCLEKKQQS
- GLSVAFDL
- KFMEREGRR
- SARIARNTQ
- AQQAVDADVH
- GDVGMAGVA
- AAGHKTLVPELIKEL
- RGPYPTMY
- THRGYDSD
- TQSLHTN
- VIVGVNKY
- KKVFGEHKANDRMVSGAYRQEFGESKEI
- VLAIDNTSVRN
- ISISGYHMQEAG
- GTIQNDILKEFMVRNTYI
- MEIAKMRA
- VSMTMNGAV
- TVGEITDA
- EVGVSNVFGPGTRIP
- AKMGQDGHDRG
- LGRPDILVMCGGVIPPQDYEFL
- QRLLHQQQPLHPEWAALAKKQLKGKNPE
- AVDADVHAVGVST
- FAPRLSFFW
- WHTPEGI
- NSFDEALGLPTVKSARIARNT
- LFLLSPH
- AAVQVLDDIEKCL
Post-translational modifications for MUT Gene
Other Protein References for MUT Gene
- ENSEMBL proteins:
- REFSEQ proteins:
Antibody Products
- Novus Biologicals Antibodies for MUT
- antibodies-online Antibodies for MUT: See all 16
- GeneTex MUT antibody for MUT
-
Santa Cruz Biotechnology (SCBT) Antibodies for MUT
Protein Products
-
OriGene Purified Proteins for MUT
- Search Origene for MassSpec and Protein Over-expression Lysates for MUT
- Origene Custom Protein Services for MUT
- antibodies-online Proteins for MUT: See all 4
- Search antibodies-online for peptides
- Search GeneTex for Proteins for MUT
Assay Products
- antibodies-online Kits for MUT: See all 4
Domains & Families for MUT Gene
Protein Domains for MUT Gene
Suggested Antigen Peptide Sequences for MUT Gene
- GenScript: Design optimal peptide antigens:
Graphical View of Domain Structure for InterPro Entry
P22033UniProtKB/Swiss-Prot:
MUTA_HUMAN :- Contains 1 B12-binding domain.
- Belongs to the methylmalonyl-CoA mutase family.
- Domain:
-
- Contains 1 B12-binding domain.
- Family:
-
- Belongs to the methylmalonyl-CoA mutase family.
No data available for Gene Families for MUT Gene
Function for MUT Gene
Molecular function for MUT Gene
- GENATLAS Biochemistry:
- methylmalonyl-CoA mutase
- UniProtKB/Swiss-Prot BiophysicochemicalProperties:
- Kinetic parameters: KM=4.7 nM for adenosylcob(III)alamin {ECO:0000269 PubMed:25125334};
- UniProtKB/Swiss-Prot CatalyticActivity:
- (R)-methylmalonyl-CoA = succinyl-CoA.
- UniProtKB/Swiss-Prot Function:
- Involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle. MCM has different functions in other species.
Enzyme Numbers (IUBMB) for MUT Gene
- EC 5.4.99.2 63 4
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0004494 | methylmalonyl-CoA mutase activity | IEA | -- |
| GO:0072341 | modified amino acid binding | IDA | 20031578 |
Phenotypes for MUT Gene
- MGI mutant phenotypes for MUT:
-
inferred from 2 alleles
- cellular phenotype
- mortality/aging
- behavior/neurological phenotype
- endocrine/exocrine gland phenotype
- liver/biliary system phenotype
- immune system phenotype
- cardiovascular system phenotype
- growth/size/body region phenotype
- homeostasis/metabolism phenotype
- digestive/alimentary phenotype
- respiratory system phenotype
- nervous system phenotype
- renal/urinary system phenotype
- other phenotype
- GenomeRNAi human phenotypes for MUT:
Animal Model Products
- Taconic Biosciences: Generate A Custom CRISPR Mouse Model For Your Study
-
ViGene Biosciences lentiviral particle packaged cDNA for MUT gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MUT gene
- Search ViGene Biosciences for MUT
CRISPR Products
-
OriGene CRISPR knockouts for MUT
-
Santa Cruz Biotechnology (SCBT) CRISPR for MUT
- GenScript: Design CRISPR guide RNA sequences for MUT
miRNA for MUT Gene
- miRTarBase miRNAs that target MUT
-
- hsa-mir-155-5p (MIRT020551)
- hsa-mir-615-3p (MIRT039809)
- hsa-mir-4776-3p (MIRT620899)
- hsa-mir-4715-3p (MIRT620900)
- hsa-mir-3064-3p (MIRT620901)
- hsa-mir-4753-3p (MIRT620902)
- hsa-mir-6749-3p (MIRT620903)
- hsa-mir-130b-5p (MIRT620904)
- hsa-mir-150-5p (MIRT620905)
- hsa-mir-186-3p (MIRT620906)
- hsa-mir-8063 (MIRT620907)
- hsa-mir-483-3p (MIRT620908)
- hsa-mir-216b-5p (MIRT620909)
miRNA Products
- Search ViGene Biosciences for MUT
Inhibitory RNA Products
- Origene siRNA, RNAi, shRNA, and mouse_rna products in human, mouse, rat for MUT
- Browse OriGene Inhibitory RNA Products For MUT
-
ViGene Biosciences ready-to-package AAV shRNAs for MUT gene
Clone Products
- OriGene clones in human for MUT
- OriGene ORF clones in human,mouse for MUT
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
Cell Line Products
-
ViGene Biosciences adenoviral particle packaged cDNA for MUT gene
-
ViGene Biosciences lentiviral particle packaged cDNA for MUT gene
-
ViGene Biosciences ready-to-package AAV shRNAs for MUT gene
Flow Cytometry Products
No data available for Transcription Factor Targets and HOMER Transcription for MUT Gene
Localization for MUT Gene
Subcellular locations from UniProtKB/Swiss-Prot for MUT Gene
- Mitochondrion matrix.
| Compartment | Confidence |
|---|---|
| mitochondrion | 5 |
| cytosol | 4 |
| lysosome | 1 |
| nucleus | 1 |
| plasma membrane | 1 |
| vacuole | 1 |
No data available for Gene Ontology (GO) - Cellular Components for MUT Gene
Pathways & Interactions for MUT Gene
More details on SuperPathways for MUT| Superpath | Contained pathways | ||
|---|---|---|---|
| 1 | Metabolism |
.38
|
|
| 2 | Diseases of metabolism | ||
| 3 | Mitochondrial Fatty Acid Beta-Oxidation | ||
| 4 | Defective MMAA causes methylmalonic aciduria type cblA | ||
| 5 | Metabolism of water-soluble vitamins and cofactors |
Pathways by source for MUT Gene
3 BioSystems pathways for MUT Gene
Interacting Proteins for MUT Gene
| GO ID | Qualified GO term | Evidence | PubMed IDs |
|---|---|---|---|
| GO:0006767 | water-soluble vitamin metabolic process | TAS | -- |
| GO:0008152 | metabolic process | IEA | -- |
| GO:0009791 | post-embryonic development | IEA | -- |
| GO:0044255 | cellular lipid metabolic process | TAS | -- |
| GO:0050667 | homocysteine metabolic process | IDA | 20031578 |
No data available for SIGNOR curated interactions for MUT Gene
Drugs & Compounds for MUT Gene
| Name | Synonyms | Role | CAS Number | PubChem IDs | PubMed IDs | |
|---|---|---|---|---|---|---|
| adenosylcobalamin |
|
13870-90-1 |
|
|||
| Methylmalonyl-CoA |
|
104809-02-1 |
|
|||
| R-Methylmalonyl-CoA |
|
73173-92-9 |
|
Transcripts for MUT Gene
mRNA/cDNA for MUT Gene
- (2) REFSEQ mRNAs :
- (5) Additional mRNA sequences :
- (286) Selected AceView cDNA sequences:
- (1) Ensembl transcripts including schematic representations, and UCSC links where relevant :
Unigene Clusters for MUT Gene
CRISPR Products
-
OriGene CRISPR knockouts for MUT
-
Santa Cruz Biotechnology (SCBT) CRISPR for MUT
- GenScript: Design CRISPR guide RNA sequences for MUT
miRNA Products
- Search ViGene Biosciences for MUT
Inhibitory RNA Products
- Origene siRNA, RNAi, shRNA, and mouse_rna products in human, mouse, rat for MUT
- Browse OriGene Inhibitory RNA Products For MUT
-
ViGene Biosciences ready-to-package AAV shRNAs for MUT gene
Clone Products
- OriGene clones in human for MUT
- OriGene ORF clones in human,mouse for MUT
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
Flow Cytometry Products
| ExUns: | 1a | · | 1b | · | 1c | · | 1d | ^ | 2 | ^ | 3a | · | 3b | ^ | 4 | ^ | 5 | ^ | 6a | · | 6b | ^ | 7 | ^ | 8 | ^ | 9 | ^ | 10 | ^ | 11 | ^ | 12 | ^ | 13 |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| SP1: | - | ||||||||||||||||||||||||||||||||||
| SP2: | |||||||||||||||||||||||||||||||||||
| SP3: | - | ||||||||||||||||||||||||||||||||||
| SP4: | - |
Expression for MUT Gene
mRNA differential expression in normal tissues according to GTEx for MUT Gene
This gene is overexpressed in Liver (x4.1).
This gene is overexpressed in Liver (12.2), Liver, secretome (6.9), and Nasal epithelium (6.4).
Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MOPED, and MaxQB for MUT Gene
SOURCE GeneReport for Unigene cluster for MUT Gene Hs.485527
- Elite partner
Primer Products
-
OriGene qPCR primer pairs and template standards for MUT
-
OriGene qPCR primer pairs for MUT
No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery and mRNA Expression by UniProt/SwissProt for MUT Gene
Orthologs for MUT Gene
This gene was present in the common ancestor of animals.
| Organism | Taxonomy | Gene | Similarity | Type | Details |
|---|---|---|---|---|---|
| cow (Bos Taurus) |
Mammalia | MUT 35 |
|
||
| MUT 36 |
|
OneToOne | |||
| dog (Canis familiaris) |
Mammalia | MUT 35 |
|
||
| MUT 36 |
|
OneToOne | |||
| mouse (Mus musculus) |
Mammalia | Mut 35 |
|
||
| Mut 16 |
|
||||
| Mut 36 |
|
OneToOne | |||
| chimpanzee (Pan troglodytes) |
Mammalia | MUT 35 |
|
||
| MUT 36 |
|
OneToOne | |||
| rat (Rattus norvegicus) |
Mammalia | Mut 35 |
|
||
| oppossum (Monodelphis domestica) |
Mammalia | MUT 36 |
|
OneToOne | |
| platypus (Ornithorhynchus anatinus) |
Mammalia | MUT 36 |
|
OneToOne | |
| chicken (Gallus gallus) |
Aves | MUT 35 |
|
||
| MUT 36 |
|
OneToOne | |||
| lizard (Anolis carolinensis) |
Reptilia | MUT 36 |
|
OneToOne | |
| tropical clawed frog (Silurana tropicalis) |
Amphibia | mut 35 |
|
||
| Str.10358 35 |
|
||||
| African clawed frog (Xenopus laevis) |
Amphibia | Xl.4891 35 |
|
||
| zebrafish (Danio rerio) |
Actinopterygii | Dr.7055 35 |
|
||
| mut 35 |
|
||||
| mut 36 |
|
OneToOne | |||
| worm (Caenorhabditis elegans) |
Secernentea | ZK1058.1 37 |
|
|
|
| mmcm-1 35 |
|
||||
| mmcm-1 36 |
|
OneToOne | |||
| sea squirt (Ciona intestinalis) |
Ascidiacea | Cin.4477 35 |
|
||
| sea squirt (Ciona savignyi) |
Ascidiacea | -- 36 |
|
OneToOne |
- Species with no ortholog for MUT:
-
- A. gosspyii yeast (Ashbya gossypii)
- Actinobacteria (Mycobacterium tuberculosis)
- African malaria mosquito (Anopheles gambiae)
- Alicante grape (Vitis vinifera)
- alpha proteobacteria (Wolbachia pipientis)
- amoeba (Dictyostelium discoideum)
- Archea (Pyrococcus horikoshii)
- baker's yeast (Saccharomyces cerevisiae)
- barley (Hordeum vulgare)
- beta proteobacteria (Neisseria meningitidis)
- bread mold (Neurospora crassa)
- Chromalveolata (Phytophthora infestans)
- common water flea (Daphnia pulex)
- corn (Zea mays)
- E. coli (Escherichia coli)
- filamentous fungi (Aspergillus nidulans)
- Firmicute bacteria (Streptococcus pneumoniae)
- fission yeast (Schizosaccharomyces pombe)
- fruit fly (Drosophila melanogaster)
- green algae (Chlamydomonas reinhardtii)
- honey bee (Apis mellifera)
- K. lactis yeast (Kluyveromyces lactis)
- loblloly pine (Pinus taeda)
- malaria parasite (Plasmodium falciparum)
- medicago trunc (Medicago Truncatula)
- moss (Physcomitrella patens)
- orangutan (Pongo pygmaeus)
- pig (Sus scrofa)
- rainbow trout (Oncorhynchus mykiss)
- rice (Oryza sativa)
- rice blast fungus (Magnaporthe grisea)
- schistosome parasite (Schistosoma mansoni)
- sea anemone (Nematostella vectensis)
- sea urchin (Strongylocentrotus purpuratus)
- sorghum (Sorghum bicolor)
- soybean (Glycine max)
- stem rust fungus (Puccinia graminis)
- sugarcane (Saccharum officinarum)
- thale cress (Arabidopsis thaliana)
- tomato (Lycopersicon esculentum)
- toxoplasmosis (Toxoplasma gondii)
- Trichoplax (Trichoplax adhaerens)
- wheat (Triticum aestivum)
Paralogs for MUT Gene
No data available for Paralogs for MUT Gene
Variants for MUT Gene
| SNP ID | Clin | Chr 06 pos | Sequence Context | AA Info | Type |
|---|---|---|---|---|---|
| rs121918251 | Methylmalonic aciduria type mut (MMAM) | 49,459,189(-) | CACAC(A/G)TGGAC | reference, missense | |
| VAR_004410 | Methylmalonic aciduria type mut (MMAM) | ||||
| VAR_004411 | Methylmalonic aciduria type mut (MMAM) | ||||
| VAR_004412 | Methylmalonic aciduria type mut (MMAM) | ||||
| VAR_004413 | Methylmalonic aciduria type mut (MMAM) |
Residual Variation Intolerance Score:
43% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score:
9.94;
89.87% of all genes are more intolerant (likely to be disease-causing)
Relevant External Links for MUT Gene
- Human Gene Mutation Database (HGMD)
- MUT
No data available for Polymorphic Variants from UniProtKB/Swiss-Prot and Structural Variations from Database of Genomic Variants (DGV) for MUT Gene
Disorders for MUT Gene
(24) MalaCards diseases for MUT Gene - From: OMIM, ClinVar, GeneTests, Orphanet, Swiss-Prot, DISEASES, Novoseek, and GeneCards
| Disorder | Aliases | PubMed IDs |
|---|---|---|
| methylmalonic aciduria, mut(0) type |
|
|
| methylmalonic acidemia |
|
|
| clove syndrome, somatic |
|
|
| megalencephaly-capillary malformation-polymicrogyria syndrome, somatic |
|
|
| cowden syndrome 5 |
|
|
Search MUT in MalaCards
View complete list of genes associated with diseases
UniProtKB/Swiss-Prot
MUTA_HUMAN- Methylmalonic aciduria type mut (MMAM) [MIM:251000]: An often fatal disorder of organic acid metabolism. Common clinical features include lethargy, vomiting, failure to thrive, hypotonia, neurological deficit and early death. Two forms of the disease are distinguished by the presence (mut-) or absence (mut0) of residual enzyme activity. Mut0 patients have more severe neurological manifestations of the disease than do MUT- patients. MMAM is unresponsive to vitamin B12 therapy. {ECO:0000269 PubMed:10923046, ECO:0000269 PubMed:11350191, ECO:0000269 PubMed:1346616, ECO:0000269 PubMed:1351030, ECO:0000269 PubMed:15643616, ECO:0000269 PubMed:15781192, ECO:0000269 PubMed:16281286, ECO:0000269 PubMed:1670635, ECO:0000269 PubMed:17113806, ECO:0000269 PubMed:1977311, ECO:0000269 PubMed:22727635, ECO:0000269 PubMed:26615597, ECO:0000269 PubMed:7909321, ECO:0000269 PubMed:7912889, ECO:0000269 PubMed:9285782, ECO:0000269 PubMed:9452100, ECO:0000269 PubMed:9554742}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Genatlas disease for MUT Gene
hyperglycinemia,ketotic methylmalonic acidemia
Relevant External Links for MUT
Publications for MUT Gene
- [Analysis of the MUT gene mutations in patients with methylmalonic acidemia]. (PMID: 19806564) Wang F. … Gu X. (Zhonghua Yi Xue Yi Chuan Xue Za Zhi 2009) 3 23 48 67
- Spectrum of mutations in mut methylmalonic acidemia and identification of a common Hispanic mutation and haplotype. (PMID: 16281286) Worgan L.C. … Rosenblatt D.S. (Hum. Mutat. 2006) 3 23 25 26
- Fine mapping of the autosomal recessive polycystic kidney disease locus (PKHD1) and the genes MUT, RDS, CSNK2 beta, and GSTA1 at 6p21.1-p12. (PMID: 9503014) MA1cher G. … Zerres K. (Genomics 1998) 2 3 23
- Vitamin B12 and older adults. (PMID: 19904199) Stover P.J. (Curr Opin Clin Nutr Metab Care 2010) 25 26
- Mitochondrial dysfunction in mut methylmalonic acidemia. (PMID: 19088183) Chandler R.J. … Venditti C.P. (FASEB J. 2009) 3 23
Products for MUT Gene
- Browse R&D Systems for Antibodies
- Browse R&D Systems for Human Recombinant Proteins
- Browse R&D Systems for biochemical assays
- Browse Primary Antibodies
- Browse Proteins and Enzymes
- Browse ELISAs
- Browse Activity Assays
- Browse cDNA Clones
- Browse Cell Culture Products
- Browse Cell Selection and Detection Kits
- Browse DNA Damage and Repair Kits
- Browse ELISpot/FluoroSpot Kits and Development Modules
- Browse Flow Cytometry Kits
- Browse Immunoprecipitation Assays
- Browse Luminex Assays
- Browse Peptides
- Browse Proteome Profiler Antibody Arrays
- Browse Small Molecules
- Custom Antibody Services
- Browse OriGene ELISA Kits
- Custom Assay Services
- OriGene Purified Proteins for MUT
- Search Origene for MassSpec and Protein Over-expression Lysates for MUT
- Origene Custom Protein Services for MUT
- Origene siRNA, shRNA, mouse_rna, and RNAi products in human, mouse, rat for MUT
- Browse OriGene Inhibitory RNA Products For MUT
- OriGene qPCR primer pairs for MUT
- OriGene qPCR primer pairs and template standards for MUT
- OriGene CRISPR knockouts for MUT
- OriGene clones in human for MUT
- OriGene ORF clones in human,mouse for MUT
- Custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling
- GenScript: Next-day shipping cDNA clones in your preferred vector
- GenScript Custom Purified and Recombinant Proteins Services for MUT
- GenScript Custom Assay Services for MUT
- GenScript Custom overexpressing Cell Line Services for MUT
- GenScript: Design CRISPR guide RNA sequences for MUT
- Design optimal peptide antigens
- CloneReady with Over 120,000 Genes
- Gene Synthesis: Any Gene in Any Vector
- Vector-based siRNA and miRNA, Ready for Transfection
- Gene Mutant Library, Variants up to 10^11
- Plasmid Preparation
- GenScript Custom Peptide Services for MUT
- Novus Biologicals Antibodies for MUT
- Novus Biologicals proteins and lysates for MUT
- Novus Biologicals
- Novus Biologicals Tissue Microarrays
- Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat
- antibodies-online Antibodies for MUT: See all 16
- antibodies-online Kits for MUT: See all 4
- antibodies-online Proteins for MUT: See all 4
- Search antibodies-online for peptides
- GeneTex MUT antibody for MUT
- Search GeneTex for Proteins for MUT
- ViGene Biosciences adenoviral particle packaged cDNA for MUT gene
- ViGene Biosciences lentiviral particle packaged cDNA for MUT gene
- ViGene Biosciences lentiviral particle packaged cDNA for MUT gene
- ViGene Biosciences ready-to-package AAV shRNAs for MUT gene
- ViGene Biosciences ready-to-package AAV shRNAs for MUT gene
- ViGene Biosciences ready-to-package AAV shRNAs for MUT gene
- Search ViGene Biosciences for MUT
- Search ViGene Biosciences for MUT
- Santa Cruz Biotechnology (SCBT) Antibodies for MUT
- Search Santa Cruz Biotechnology (SCBT) for MUT siRNA/shRNA
- Santa Cruz Biotechnology (SCBT) CRISPR for MUT
Sources for MUT Gene
- (1) GeneCards
- (2) HGNC
- (3) EntrezGene
- (4) Swiss-Prot
- (5) Ensembl
- (6) OMIM
- (7) GeneLoc
- (8) Gene Wiki
- (9) UCSC
- (10) PhosphoSitePlus
- (11) GO
- (12) TrEMBL
- (13) InterPro
- (14) ProtoNet
- (15) Blocks
- (16) MGI
- (17) IUBMB
- (18) KEGG
- (19) MINT
- (20) STRING
- (21) I2D
- (22) IntAct
- (23) Novoseek
- (24) PharmGKB
- (25) DrugBank
- (26) HMDB
- (27) UniGene
- (28) AceView
- (29) RNAdb
- (30) ASD
- (31) ECgene
- (32) GeneAnnot
- (33) SAGE
- (34) SOURCE
- (35) HomoloGene
- (36) PanEnsembl
- (37) euGenes
- (38) SGD
- (39) FlyBase
- (40) WormBase
- (41) Pseudogene
- (42) DGV
- (43) dbSNP
- (44) HapMap
- (45) GenAtlas
- (46) GeneTests
- (47) HGMD
- (48) GAD
- (49) LSDB
- (50) BGMUT
- (51) HuGE
- (52) eBioscience
- (53) Atlas
- (54) Cell Signaling Technology
- (55) GenBank
- (56) H-invDB
- (57) HORDE
- (58) HUGE
- (59) IMGT
- (60) Leiden
- (61) MILLIPORE
- (62) miRBase
- (63) DME
- (64) Nature
- (65) NCBI
- (66) OriGene
- (67) PubMed
- (68) R&D Systems
- (69) Salk
- (70) TGDB
- (71) Tufts
- (72) YEDA
- (73) CROW21
- (74) Tocris
- (75) Abcam
- (76) Novus
- (77) ProSpec
- (78) Sino Biological
- (79) GenScript
- (80) Qiagen
- (81) Cloud-Clone Corp.
- (82) Enzo Life Sciences
- (83) OCA
- (84) Proteopedia
- (85) MOPED
- (86) SPIRE
- (87) neXtProt
- (88) Reactome
- (89) GeneGo (Thomson Reuters)
- (90) fRNAdb
- (91) DISEASES
- (92) SIMAP
- (93) GenomeRNAi
- (94) LifeMap
- (95) miRTarBase
- (96) MalaCards
- (97) Invitrogen
- (98) BitterDB
- (99) Vector BioLabs
- (100) ESI-BIO
- (101) RefSeq
- (102) BioSystems
- (103) MaxQB
- (104) IUPHAR
- (105) BioGPS
- (106) Illumina
- (107) COMPARTMENTS
- (108) HOMER
- (109) PaxDb
- (110) ApexBio
- (111) Addgene
- (112) Advanced Cell Diagnostics
- (113) antibodies-online
- (114) CYP
- (115) NONCODE
- (116) SwitchGear Genomics
- (117) TreeFam
- (118) PathCards
- (119) GeneReviews
- (120) GeneTex
- (121) Taconic Biosciences
- (122) GTEx
- (123) ProteomicsDB
- (124) SCBT
- (125) DGIdb
- (126) ClinicalTrials
- (127) FDA Approved Drugs
- (128) RVIS
- (129) SIGNOR
- (130) diseasecard
- (131) NIH Rare Diseases
- (132) Orphanet
- (133) UMLS
- (134) GTR
- (135) Disease Ontology
- (136) Genetics Home Reference
- (137) MeSH
- (138) MedlinePlus
- (139) CDC
- (140) NINDS
- (141) NCBI Bookshelf
- (142) ClinVar
- (143) Gene Damage Index
- (144) ViGene Biosciences
- (145) HPO
- (146) UDN
- (147) VISTA
- (148) FANTOM5
- (149) ENCODE
- (150) ProSci
- (151) Horizon