Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MMP14 Gene

Aliases for MMP14 Gene

  • Matrix Metallopeptidase 14 2 3 5
  • Matrix Metallopeptidase 14 (Membrane-Inserted) 2 3
  • Membrane-Type-1 Matrix Metalloproteinase 3 4
  • Membrane Type 1 Metalloprotease 2 3
  • EC 3.4.24.80 4 61
  • MT-MMP 1 3 4
  • MT1-MMP 3 4
  • MMP-14 3 4
  • MMP-X1 3 4
  • MT1MMP 3 4
  • MTMMP1 3 4
  • Matrix Metalloproteinase 14 (Membrane-Inserted) 2
  • Membrane-Type Matrix Metalloproteinase 1 4
  • Matrix Metalloproteinase-14 3
  • EC 3.4.24 61
  • MT-MMP 3
  • WNCHRS 3

External Ids for MMP14 Gene

Previous GeneCards Identifiers for MMP14 Gene

  • GC14P020678
  • GC14P017093
  • GC14P021295
  • GC14P022375
  • GC14P023305
  • GC14P003422
  • GC14P022837
  • GC14P022839
  • GC14P023827

Summaries for MMP14 Gene

Entrez Gene Summary for MMP14 Gene

  • Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 protein, and this activity may be involved in tumor invasion. [provided by RefSeq, Jul 2008]

GeneCards Summary for MMP14 Gene

MMP14 (Matrix Metallopeptidase 14) is a Protein Coding gene. Diseases associated with MMP14 include Winchester Syndrome and Multicentric Osteolysis, Nodulosis, And Arthropathy. Among its related pathways are Degradation of the extracellular matrix and Adhesion. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and metalloendopeptidase activity. An important paralog of this gene is MMP15.

UniProtKB/Swiss-Prot for MMP14 Gene

  • Seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2.

Tocris Summary for MMP14 Gene

  • Matrix metalloproteases (matrix metalloproteinase, MMPs), also called matrixins, are zinc-dependent endopeptidases and the major proteases in ECM degradation. MMPs are capable of degrading several extracellular molecules and a number of bioactive molecules.

Gene Wiki entry for MMP14 Gene

No data available for CIViC summary , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MMP14 Gene

Genomics for MMP14 Gene

Regulatory Elements for MMP14 Gene

Enhancers for MMP14 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH14G022504 2.1 FANTOM5 Ensembl ENCODE dbSUPER 37.8 -298.3 -298346 66.7 CREB3L1 MLX AGO1 ZFP64 DMAP1 FEZF1 YBX1 YY1 SLC30A9 ZNF143 MMP14 ABHD4 OXA1L EFS BCL2L2-PABPN1 DAD1 LOC105370399 TRAC C14orf119 OR6J1
GH14G022976 1.9 FANTOM5 ENCODE dbSUPER 22.6 +143.4 143373 7.6 MLX CREB3L1 ZFP64 FEZF1 DMAP1 YBX1 YY1 SLC30A9 ZNF143 ZNF548 PRMT5 HAUS4 LOC102724814 MMP14 PSMB5 C14orf119 CDH24 C14orf93 PSMB11 PABPN1
GH14G022587 1.7 FANTOM5 ENCODE dbSUPER 23.2 -247.5 -247460 3.2 MLX CREB3L1 AGO1 ZFP64 DMAP1 YBX1 YY1 SLC30A9 ZNF143 ZNF263 MMP14 PABPN1 OXA1L DAD1 ABHD4 OR6J1 BCL2L2 LRP10 REM2 LINC02332
GH14G023566 1.4 Ensembl ENCODE 22.5 +731.8 731791 3.7 MLX AGO1 ZFP64 DMAP1 YY1 SLC30A9 ZNF143 ZNF548 ZNF263 SP3 KHNYN RNA5SP383 MMP14 NYNRIN AP1G2 C14orf119 LOC102724814 NFATC4 HOMEZ ABHD4
GH14G023445 1.1 ENCODE dbSUPER 21.4 +610.5 610538 3.1 ZFP64 ZNF121 ZNF202 ZNF680 ZBTB11 ZNF426 REST ZNF623 ZNF781 ZNF518A NYNRIN KHNYN NFATC4 RNA5SP383 MMP14 MIR208B HOMEZ MYH6 THTPA SLC22A17
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around MMP14 on UCSC Golden Path with GeneCards custom track

Promoters for MMP14 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000066650 967 2201 HDGF MLX ARNT AGO1 ZFP64 ARID4B SIN3A DMAP1 FEZF1 ZNF2

Genomic Location for MMP14 Gene

Chromosome:
14
Start:
22,836,533 bp from pter
End:
22,849,027 bp from pter
Size:
12,495 bases
Orientation:
Plus strand

Genomic View for MMP14 Gene

Genes around MMP14 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MMP14 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MMP14 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MMP14 Gene

Proteins for MMP14 Gene

  • Protein details for MMP14 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    P50281-MMP14_HUMAN
    Recommended name:
    Matrix metalloproteinase-14
    Protein Accession:
    P50281
    Secondary Accessions:
    • A8K5L0
    • Q6GSF3
    • Q92678

    Protein attributes for MMP14 Gene

    Size:
    582 amino acids
    Molecular mass:
    65894 Da
    Cofactor:
    Name=Ca(2+); Xref=ChEBI:CHEBI:29108;
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    • Interacts (via C-terminal cytoplasmic tail) with BST2. Interacts with DLL1; inhibits DLL1-induced Notch signaling (PubMed:21572390).

    Three dimensional structures from OCA and Proteopedia for MMP14 Gene

neXtProt entry for MMP14 Gene

Selected DME Specific Peptides for MMP14 Gene

P50281:
  • GGFLAHAYFPGP
  • NYTPKVGE
  • PRCGVPD
  • AIMAPFYQ
  • RGIQQLYG
  • FVFFKGD
  • LRDWMGC
  • GHALGLEHS
  • EAIRKAFRVWESATPLRFREVPYAYIREGHEKQAD
  • AMRRPRCGVPDKFG
  • LKVEPGYP
  • LPTDKIDAALFWMPNGK
  • VLPVLLLL
  • RGEMFVFK
  • LLLPLLTLGTALASLG
  • DDRRGIQ

Post-translational modifications for MMP14 Gene

  • The precursor is cleaved by a furin endopeptidase.
  • Tyrosine phosphorylated by PKDCC/VLK.
  • Glycosylation at posLast=7777, posLast=291291, Thr299, Thr300, Ser301, and Ser304
  • Modification sites at PhosphoSitePlus

Other Protein References for MMP14 Gene

ENSEMBL proteins:
REFSEQ proteins:

Antibody Products

  • R&D Systems Antibodies for MMP14 (MMP-14/MT1-MMP)
  • Cell Signaling Technology (CST) Antibodies for MMP14 (MMP14)
  • Abcam antibodies for MMP14

Assay Products

  • Cloud-Clone Corp Assay Kits for MMP14
  • Abcam assays for MMP14

Domains & Families for MMP14 Gene

Gene Families for MMP14 Gene

Suggested Antigen Peptide Sequences for MMP14 Gene

GenScript: Design optimal peptide antigens:

Graphical View of Domain Structure for InterPro Entry

P50281

UniProtKB/Swiss-Prot:

MMP14_HUMAN :
  • The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
  • Belongs to the peptidase M10A family.
Domain:
  • The conserved cysteine present in the cysteine-switch motif binds the catalytic zinc ion, thus inhibiting the enzyme. The dissociation of the cysteine from the zinc ion upon the activation-peptide release activates the enzyme.
Family:
  • Belongs to the peptidase M10A family.
genes like me logo Genes that share domains with MMP14: view

Function for MMP14 Gene

Molecular function for MMP14 Gene

GENATLAS Biochemistry:
matrix metalloproteinase 14,regulator in matrix remodeling in the MMP cluster,membrane-type,involved in pathophysiology of malignant gliomas by glial invasion and angiogenesis,required for the activation of MMP2 in the stronal cancer cells
UniProtKB/Swiss-Prot CatalyticActivity:
Endopeptidase activity. Activates progelatinase A by cleavage of the propeptide at 37-Asn- -Leu-38. Other bonds hydrolyzed include 35-Gly- -Ile-36 in the propeptide of collagenase 3, and 341-Asn- -Phe-342, 441-Asp- -Leu-442 and 354-Gln- -Thr-355 in the aggrecan interglobular domain.
UniProtKB/Swiss-Prot Function:
Seems to specifically activate progelatinase A. May thus trigger invasion by tumor cells by activating progelatinase A on the tumor cell surface. May be involved in actin cytoskeleton reorganization by cleaving PTK7. Acts as a positive regulator of cell growth and migration via activation of MMP15. Involved in the formation of the fibrovascular tissues in association with pro-MMP2.
UniProtKB/Swiss-Prot Induction:
Up-regulated by NANOS1.

Enzyme Numbers (IUBMB) for MMP14 Gene

Gene Ontology (GO) - Molecular Function for MMP14 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004222 metalloendopeptidase activity TAS,IEA --
GO:0004252 serine-type endopeptidase activity TAS --
GO:0005178 integrin binding IEA --
GO:0005509 calcium ion binding IEA --
GO:0005515 protein binding IPI 14718544
genes like me logo Genes that share ontologies with MMP14: view
genes like me logo Genes that share phenotypes with MMP14: view

Human Phenotype Ontology for MMP14 Gene

HPO Id HPO Name Alternative Ids Definition Synonyms

Animal Models for MMP14 Gene

MGI Knock Outs for MMP14:

Animal Model Products

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for MMP14

No data available for Transcription Factor Targets and HOMER Transcription for MMP14 Gene

Localization for MMP14 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MMP14 Gene

Membrane; Single-pass type I membrane protein. Melanosome. Cytoplasm. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV. Forms a complex with BST2 and localizes to the cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MMP14 gene
Compartment Confidence
plasma membrane 5
extracellular 5
cytoskeleton 5
cytosol 5
golgi apparatus 5
endosome 5
nucleus 4
mitochondrion 1
endoplasmic reticulum 1

Gene Ontology (GO) - Cellular Components for MMP14 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005615 extracellular space IMP 24784232
GO:0005634 nucleus IMP 24784232
GO:0005737 colocalizes_with cytoplasm IDA,IEA 22065321
GO:0005796 Golgi lumen TAS --
GO:0005829 cytosol IDA --
genes like me logo Genes that share ontologies with MMP14: view

Pathways & Interactions for MMP14 Gene

genes like me logo Genes that share pathways with MMP14: view

SIGNOR curated interactions for MMP14 Gene

Is inactivated by:
Other effect:

Gene Ontology (GO) - Biological Process for MMP14 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0001525 angiogenesis IEA --
GO:0001541 ovarian follicle development IEA --
GO:0001666 response to hypoxia IEA --
GO:0001935 endothelial cell proliferation IEA --
GO:0001958 endochondral ossification IEA --
genes like me logo Genes that share ontologies with MMP14: view

Drugs & Compounds for MMP14 Gene

(44) Drugs for MMP14 Gene - From: DrugBank, ApexBio, DGIdb, HMDB, Tocris, and Novoseek

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Marimastat Approved, Investigational Pharma Target, inhibitor MMPs inhibitor,board spectrum 4
Batimastat Experimental Pharma Potent, broad spectrum MMP inhibitor 0
Prinomastat Investigational Pharma inhibitor, Vaccine Vaccines 3
calcium Nutra 0
NSC 405020 Pharma MT1-MMP inhibitor 0

(37) Additional Compounds for MMP14 Gene - From: Novoseek and Tocris

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
TMI 1
287403-39-8

(5) Tocris Compounds for MMP14 Gene

Compound Action Cas Number
Batimastat Potent, broad spectrum MMP inhibitor 130370-60-4
GI 254023X Selective ADAM10 metalloprotease inhibitor 260264-93-5
GM 6001 Broad spectrum MMP inhibitor 142880-36-2
TMI 1 Adam 17 (TACE) and MMP inhibitor; orally bioavailable 287403-39-8
WAY 170523 Potent and selective inhibitor of MMP-13 307002-73-9

(3) ApexBio Compounds for MMP14 Gene

Compound Action Cas Number
Marimastat MMPs inhibitor,board spectrum 154039-60-8
NSC 405020 MT1-MMP inhibitor 7497-07-6
Ro 32-3555 MMP inhibitor 190648-49-8
genes like me logo Genes that share compounds with MMP14: view

Drug Products

Transcripts for MMP14 Gene

Unigene Clusters for MMP14 Gene

Matrix metallopeptidase 14 (membrane-inserted):
Representative Sequences:

Inhibitory RNA Products

Clone Products

  • Addgene plasmids for MMP14

Alternative Splicing Database (ASD) splice patterns (SP) for MMP14 Gene

No ASD Table

Relevant External Links for MMP14 Gene

GeneLoc Exon Structure for
MMP14
ECgene alternative splicing isoforms for
MMP14

Expression for MMP14 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MMP14 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for MMP14 Gene

This gene is overexpressed in Amniocyte (42.1), Bone (8.3), and Liver (6.2).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, and MOPED for MMP14 Gene



Protein tissue co-expression partners for MMP14 Gene

- Elite partner

NURSA nuclear receptor signaling pathways regulating expression of MMP14 Gene:

MMP14

SOURCE GeneReport for Unigene cluster for MMP14 Gene:

Hs.2399

mRNA Expression by UniProt/SwissProt for MMP14 Gene:

P50281-MMP14_HUMAN
Tissue specificity: Expressed in stromal cells of colon, breast, and head and neck. Expressed in lung tumors.

Evidence on tissue expression from TISSUES for MMP14 Gene

  • Lung(4.7)
  • Skin(4.6)
  • Heart(2.8)
  • Nervous system(2.7)
  • Muscle(2.5)
  • Intestine(2.4)
  • Lymph node(2.4)
  • Kidney(2.3)
  • Eye(2)
  • Gall bladder(2)
  • Stomach(2)

Phenotype-based relationships between genes and organs from Gene ORGANizer for MMP14 Gene

Germ Layers:
  • ectoderm
  • endoderm
  • mesoderm
Systems:
  • digestive
  • immune
  • integumentary
  • nervous
  • respiratory
  • skeletal muscle
  • skeleton
Organs:
Head and neck:
  • chin
  • ear
  • eye
  • eyelid
  • face
  • forehead
  • head
  • jaw
  • lip
  • mandible
  • maxilla
  • mouth
  • neck
  • nose
  • skull
  • tooth
Thorax:
  • chest wall
  • clavicle
  • lung
  • rib
  • rib cage
  • scapula
  • sternum
Pelvis:
  • pelvis
Limb:
  • ankle
  • arm
  • digit
  • elbow
  • femur
  • fibula
  • finger
  • foot
  • forearm
  • hand
  • hip
  • humerus
  • knee
  • lower limb
  • radius
  • shin
  • shoulder
  • thigh
  • tibia
  • toe
  • ulna
  • upper limb
  • wrist
General:
  • blood
  • hair
  • peripheral nerve
  • peripheral nervous system
  • skin
  • spinal column
  • vertebrae
  • white blood cell
genes like me logo Genes that share expression patterns with MMP14: view

Primer Products

No data available for mRNA differential expression in normal tissues for MMP14 Gene

Orthologs for MMP14 Gene

This gene was present in the common ancestor of animals.

Orthologs for MMP14 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MMP14 34 35
  • 99.89 (n)
dog
(Canis familiaris)
Mammalia MMP-14 35
  • 97 (a)
OneToOne
MMP14 34
  • 89.9 (n)
cow
(Bos Taurus)
Mammalia MMP14 34 35
  • 92.03 (n)
mouse
(Mus musculus)
Mammalia Mmp14 34 16 35
  • 89.86 (n)
rat
(Rattus norvegicus)
Mammalia Mmp14 34
  • 89.81 (n)
oppossum
(Monodelphis domestica)
Mammalia MMP14 35
  • 88 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia MMP14 35
  • 85 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia MMP14 35
  • 82 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia mmp14 34
  • 71.75 (n)
African clawed frog
(Xenopus laevis)
Amphibia Xl.23718 34
zebrafish
(Danio rerio)
Actinopterygii mmp14b 34 34 35
  • 68.46 (n)
mmp14a 35
  • 68 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta Mmp1 36 34
  • 53.08 (n)
Mmp2 36 35
  • 30 (a)
African malaria mosquito
(Anopheles gambiae)
Insecta AgaP_AGAP006904 34
  • 49.57 (n)
worm
(Caenorhabditis elegans)
Secernentea H36L18.1 34
  • 45.74 (n)
H19M22.3a 36
  • 32 (a)
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 37 (a)
ManyToMany
Species where no ortholog for MMP14 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • chicken (Gallus gallus)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MMP14 Gene

ENSEMBL:
Gene Tree for MMP14 (if available)
TreeFam:
Gene Tree for MMP14 (if available)

Paralogs for MMP14 Gene

(18) SIMAP similar genes for MMP14 Gene using alignment to 4 proteins:

genes like me logo Genes that share paralogs with MMP14: view

Variants for MMP14 Gene

Sequence variations from dbSNP and Humsavar for MMP14 Gene

SNP ID Clin Chr 14 pos Sequence Context AA Info Type
rs587777039 Pathogenic, Winchester syndrome (WNCHRS) [MIM:277950] 22,836,867(+) GCTCA(C/G)GCTCG reference, missense
rs1000465730 -- 22,843,993(+) GAGTT(C/T)GAGAG intron-variant
rs1000492144 -- 22,841,856(+) TGGAG(A/G)CCTTT intron-variant
rs1000553192 -- 22,836,248(+) CCCCA(A/G)TAATT upstream-variant-2KB
rs1000697215 -- 22,847,208(+) GAGAG(A/G)CCACA utr-variant-3-prime

Structural Variations from Database of Genomic Variants (DGV) for MMP14 Gene

Variant ID Type Subtype PubMed ID
esv3633763 CNV gain 21293372
nsv1070211 CNV deletion 25765185
nsv1143607 CNV deletion 24896259
nsv563998 CNV gain 21841781
nsv952816 CNV deletion 24416366

Variation tolerance for MMP14 Gene

Residual Variation Intolerance Score: 23.1% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 6.83; 79.24% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for MMP14 Gene

Human Gene Mutation Database (HGMD)
MMP14
SNPedia medical, phenotypic, and genealogical associations of SNPs for
MMP14

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MMP14 Gene

Disorders for MMP14 Gene

MalaCards: The human disease database

(16) MalaCards diseases for MMP14 Gene - From: OMIM, ClinVar, Orphanet, Swiss-Prot, DISEASES, Novoseek, and GeneCards

Disorder Aliases PubMed IDs
winchester syndrome
  • winchester disease
multicentric osteolysis, nodulosis, and arthropathy
  • winchester syndrome
light chain deposition disease
  • light-chain deposition disease
klatskin's tumor
  • hilar cholangiocarcinoma
fibrosarcoma
  • fibrocytic tumor
- elite association - COSMIC cancer census association via MalaCards
Search MMP14 in MalaCards View complete list of genes associated with diseases

UniProtKB/Swiss-Prot

MMP14_HUMAN
  • Winchester syndrome (WNCHRS) [MIM:277950]: A disease characterized by severe osteolysis in the hands and feet, generalized osteoporosis, bone thinning, and absence of subcutaneous nodules. Various additional features include coarse face, corneal opacities, gum hypertrophy, and EKG changes. {ECO:0000269 PubMed:22922033}. Note=The disease is caused by mutations affecting the gene represented in this entry.

Relevant External Links for MMP14

Genetic Association Database (GAD)
MMP14
Human Genome Epidemiology (HuGE) Navigator
MMP14
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
MMP14
genes like me logo Genes that share disorders with MMP14: view

No data available for Genatlas for MMP14 Gene

Publications for MMP14 Gene

  1. Regulation of membrane-type matrix metalloproteinase-1 expression by growth factors and phorbol 12-myristate 13-acetate. (PMID: 8706726) Lohi J.L. … Keski-Oja J. (Eur. J. Biochem. 1996) 3 4 22 64
  2. A matrix metalloproteinase expressed on the surface of invasive tumour cells. (PMID: 8015608) Sato H. … Seiki M. (Nature 1994) 2 3 4 64
  3. BST-2 binding with cellular MT1-MMP blocks cell growth and migration via decreasing MMP2 activity. (PMID: 22065321) Gu G. … Liu P. (J. Cell. Biochem. 2012) 3 4 64
  4. Mutation of membrane type-1 metalloproteinase, MT1-MMP, causes the multicentric osteolysis and arthritis disease Winchester syndrome. (PMID: 22922033) Evans B.R. … Martignetti J.A. (Am. J. Hum. Genet. 2012) 3 4 64
  5. MT1-MMP cleaves Dll1 to negatively regulate Notch signalling to maintain normal B-cell development. (PMID: 21572390) Jin G. … Zhou Z. (EMBO J. 2011) 3 4 64

Products for MMP14 Gene

  • Addgene plasmids for MMP14

Sources for MMP14 Gene

Content
Loading form....