Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MIR761 Gene

Subcategory (RNA class) for MIR761 Gene

miRNA

Quality Score for this RNA gene is

3

Aliases for MIR761 Gene

  • MicroRNA 761 2 3
  • Nardilysin Convertase 4 5
  • EC 3.4.24.61 4 61
  • NRDC 4 5
  • N-Arginine Dibasic Convertase 4
  • NRD Convertase 4
  • Hsa-Mir-761 3
  • EC 3.4.24 61
  • NRD-C 4
  • NRD1 4

External Ids for MIR761 Gene

Previous GeneCards Identifiers for MIR761 Gene

  • GC00U923916
  • GC01M052303
  • GC01M050418
  • GC01M051836

Summaries for MIR761 Gene

Entrez Gene Summary for MIR761 Gene

  • microRNAs (miRNAs) are short (20-24 nt) non-coding RNAs that are involved in post-transcriptional regulation of gene expression in multicellular organisms by affecting both the stability and translation of mRNAs. miRNAs are transcribed by RNA polymerase II as part of capped and polyadenylated primary transcripts (pri-miRNAs) that can be either protein-coding or non-coding. The primary transcript is cleaved by the Drosha ribonuclease III enzyme to produce an approximately 70-nt stem-loop precursor miRNA (pre-miRNA), which is further cleaved by the cytoplasmic Dicer ribonuclease to generate the mature miRNA and antisense miRNA star (miRNA*) products. The mature miRNA is incorporated into a RNA-induced silencing complex (RISC), which recognizes target mRNAs through imperfect base pairing with the miRNA and most commonly results in translational inhibition or destabilization of the target mRNA. The RefSeq represents the predicted microRNA stem-loop. [provided by RefSeq, Sep 2009]

GeneCards Summary for MIR761 Gene

MIR761 (MicroRNA 761) is an RNA Gene, and is affiliated with the miRNA class. An important paralog of this gene is IDE.

UniProtKB/Swiss-Prot for MIR761 Gene

  • Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

No data available for Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MIR761 Gene

Genomics for MIR761 Gene

Regulatory Elements for MIR761 Gene

Enhancers for MIR761 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH01F051563 1.4 Ensembl ENCODE 10.2 +310.9 310920 9.3 HDGF PKNOX1 ARNT MLX CREB3L1 ARID4B SIN3A DMAP1 ZNF2 YY1 ENSG00000266993 RNU6-1281P ENSG00000227070 EPS15 ZCCHC11 ENSG00000272100 MIR761 NRDC RNU6-877P CALR4P
GH01F051642 1.3 FANTOM5 Ensembl ENCODE 10.3 +235.1 235137 3.5 PKNOX1 JUN ZNF384 RAD21 CTBP1 ZNF366 PRDM10 FOS KLF8 ZNF362 OSBPL9 ENSG00000212624 MIR761 NRDC RNU6-877P LOC105378719 GAPDHP51
GH01F051733 1.1 Ensembl ENCODE 10.6 +144.6 144637 3.0 PKNOX1 WRNIP1 ZNF366 HMG20B REST ZFP69B GLIS1 THRAP3 IKZF1 CEBPA ZCCHC11 ENSG00000266993 MIR761 NRDC GC01P051733
GH01F051736 1.1 Ensembl ENCODE 10.6 +142.0 142019 0.6 HDGF TBL1XR1 JUN FEZF1 ZBTB40 CHAMP1 ZNF316 FOXK2 NFE2 MAFK MIR761 NRDC GC01P051733 ENSG00000266993
GH01F051728 1.1 ENCODE 10.4 +149.0 149031 3.4 ARNT CREB3L1 WRNIP1 ARID4B SIN3A DMAP1 ZNF2 SLC30A9 ZNF207 FOS TXNDC12 MIR761 NRDC KTI12 RNU6-877P OSBPL9 GC01P051732 ENSG00000212624
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around MIR761 on UCSC Golden Path with GeneCards custom track

Promoters for MIR761 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001520167 937 4001 CREB3L1 MLX DMAP1 YY1 ZNF143 ZNF548 ZNF263 SP3 NFYC TBX21

Genomic Location for MIR761 Gene

Chromosome:
1
Start:
51,789,191 bp from pter
End:
51,878,937 bp from pter
Size:
89,747 bases
Orientation:
Minus strand

Genomic View for MIR761 Gene

Genes around MIR761 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MIR761 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MIR761 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MIR761 Gene

Proteins for MIR761 Gene

  • Protein details for MIR761 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O43847-NRDC_HUMAN
    Recommended name:
    Nardilysin
    Protein Accession:
    O43847
    Secondary Accessions:
    • A6NI41
    • O15241
    • O15242
    • Q5VUL0
    • Q96HB2
    • Q9NU57

    Protein attributes for MIR761 Gene

    Size:
    1150 amino acids
    Molecular mass:
    131572 Da
    Cofactor:
    Name=Zn(2+); Xref=ChEBI:CHEBI:29105;
    Quaternary structure:
    No Data Available

    Alternative splice isoforms for MIR761 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MIR761 Gene

Selected DME Specific Peptides for MIR761 Gene

O43847:
  • NILTHNLAEPAYEADVAQLEYKLVAGEHGLIIRVKGFNHK
  • SAANVVLFDIF
  • GHEGKGSILS

Post-translational modifications for MIR761 Gene

  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for MIR761 Gene

Domains & Families for MIR761 Gene

Gene Families for MIR761 Gene

Graphical View of Domain Structure for InterPro Entry

O43847

UniProtKB/Swiss-Prot:

NRDC_HUMAN :
  • Belongs to the peptidase M16 family.
Family:
  • Belongs to the peptidase M16 family.
genes like me logo Genes that share domains with MIR761: view

No data available for Suggested Antigen Peptide Sequences for MIR761 Gene

Function for MIR761 Gene

Molecular function for MIR761 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
Hydrolysis of polypeptides, preferably at -Xaa- -Arg-Lys-, and less commonly at -Arg- -Arg-Xaa-, in which Xaa is not Arg or Lys.
UniProtKB/Swiss-Prot Function:
Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Enzyme Numbers (IUBMB) for MIR761 Gene

Gene Ontology (GO) - Molecular Function for MIR761 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004222 metalloendopeptidase activity IEA --
GO:0005515 protein binding IPI --
GO:0008233 peptidase activity IEA --
GO:0008237 metallopeptidase activity IEA --
GO:0008270 zinc ion binding IBA --
genes like me logo Genes that share ontologies with MIR761: view

Animal Model Products

miRNA Products

Clone Products

Flow Cytometry Products

No data available for Phenotypes , Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for MIR761 Gene

Localization for MIR761 Gene

Gene Ontology (GO) - Cellular Components for MIR761 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005739 mitochondrion IEA --
GO:0005829 cytosol TAS --
GO:0009986 cell surface TAS --
genes like me logo Genes that share ontologies with MIR761: view

No data available for Subcellular locations from UniProtKB/Swiss-Prot and Subcellular locations from COMPARTMENTS for MIR761 Gene

Pathways & Interactions for MIR761 Gene

SuperPathways for MIR761 Gene

No Data Available

Gene Ontology (GO) - Biological Process for MIR761 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006508 proteolysis IEA --
GO:0007528 neuromuscular junction development TAS --
GO:0008283 cell proliferation TAS --
GO:0016477 cell migration TAS --
GO:0016485 protein processing IBA --
genes like me logo Genes that share ontologies with MIR761: view

No data available for Pathways by source and SIGNOR curated interactions for MIR761 Gene

Transcripts for MIR761 Gene

mRNA/cDNA for MIR761 Gene

(15) Ensembl transcripts including schematic representations, and UCSC links where relevant :

Alternative Splicing Database (ASD) splice patterns (SP) for MIR761 Gene

No ASD Table

Relevant External Links for MIR761 Gene

GeneLoc Exon Structure for
MIR761
ECgene alternative splicing isoforms for
MIR761

Expression for MIR761 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for MIR761 Gene

mRNA differential expression in normal tissues according to GTEx for MIR761 Gene

This gene is overexpressed in Muscle - Skeletal (x6.2).

NURSA nuclear receptor signaling pathways regulating expression of MIR761 Gene:

MIR761

mRNA Expression by UniProt/SwissProt for MIR761 Gene:

O43847-NRDC_HUMAN
Tissue specificity: Primarily in adult heart, skeletal muscle, and testis and at much lower levels in other tissues.
genes like me logo Genes that share expression patterns with MIR761: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein differential expression in normal tissues , Protein expression and Protein tissue co-expression partners for MIR761 Gene

Orthologs for MIR761 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for MIR761 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia NRD1 35
  • 100 (a)
OneToOne
cow
(Bos Taurus)
Mammalia NRD1 35
  • 95 (a)
OneToOne
dog
(Canis familiaris)
Mammalia NRD1 35
  • 93 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Nrd1 35
  • 92 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia NRD1 35
  • 83 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia NRD1 35
  • 75 (a)
OneToOne
chicken
(Gallus gallus)
Aves NRD1 35
  • 75 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia -- 35
  • 70 (a)
OneToMany
-- 35
  • 64 (a)
OneToMany
zebrafish
(Danio rerio)
Actinopterygii NRD1 (1 of 2) 35
  • 69 (a)
OneToMany
nrd1 35
  • 64 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta CG10588 35
  • 31 (a)
OneToMany
CG2025 35
  • 31 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes STE23 35
  • 27 (a)
OneToMany
Species where no ortholog for MIR761 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rat (Rattus norvegicus)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea squirt (Ciona intestinalis)
  • sea squirt (Ciona savignyi)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)
  • worm (Caenorhabditis elegans)

Evolution for MIR761 Gene

ENSEMBL:
Gene Tree for MIR761 (if available)
TreeFam:
Gene Tree for MIR761 (if available)

Paralogs for MIR761 Gene

Paralogs for MIR761 Gene

genes like me logo Genes that share paralogs with MIR761: view

Variants for MIR761 Gene

Sequence variations from dbSNP and Humsavar for MIR761 Gene

SNP ID Clin Chr 01 pos Sequence Context AA Info Type
rs1053031 -- 51,837,451(-) GGTTA(G/T)ATTGT intron-variant, upstream-variant-2KB
rs112209098 -- 51,837,232(+) ATATT(-/T)GGTGA intron-variant, upstream-variant-2KB
rs112283066 -- 51,837,648(+) AGAAT(C/T)TTCTA intron-variant, upstream-variant-2KB
rs113912559 -- 51,837,809(+) GAAAA(C/T)GGAGA intron-variant, upstream-variant-2KB
rs115629064 -- 51,836,092(+) GGGGG(A/G)AAAAA intron-variant, downstream-variant-500B

Relevant External Links for MIR761 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MIR761

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot , Structural Variations from Database of Genomic Variants (DGV) and Variation tolerance for MIR761 Gene

Disorders for MIR761 Gene

Relevant External Links for MIR761

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
MIR761

No disorders were found for MIR761 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MIR761 Gene

Publications for MIR761 Gene

  1. MicroRNA-761 is upregulated in hepatocellular carcinoma and regulates tumorigenesis by targeting Mitofusin-2. (PMID: 26845057) Zhou X. … Wang W. (Cancer Sci. 2016) 3 64
  2. An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. (PMID: 24275569) Bian Y. … Zou H. (J. Proteomics 2014) 4 64
  3. Toward a comprehensive characterization of a human cancer cell phosphoproteome. (PMID: 23186163) Zhou H. … Mohammed S. (J. Proteome Res. 2013) 4 64
  4. Initial characterization of the human central proteome. (PMID: 21269460) Burkard T.R. … Colinge J. (BMC Syst. Biol. 2011) 4 64
  5. System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. (PMID: 21406692) Rigbolt K.T. … Blagoev B. (Sci. Signal. 2011) 4 64

Products for MIR761 Gene

Sources for MIR761 Gene

Content
Loading form....