Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MIR4523 Gene

Subcategory (RNA class) for MIR4523 Gene

miRNA

Quality Score for this RNA gene is

3

Aliases for MIR4523 Gene

  • MicroRNA 4523 2 3
  • EC 2.7.11.1 4 61
  • TAOK1 4 5
  • Thousand And One Amino Acid Protein Kinase 1 4
  • Prostate-Derived Sterile 20-Like Kinase 2 4
  • Prostate-Derived STE20-Like Kinase 2 4
  • Kinase From Chicken Homolog B 4
  • Hsa-Mir-4523 3
  • TAO Kinase 1 5
  • MARK Kinase 4
  • EC 2.7.11 61
  • KIAA1361 4
  • MAP3K16 4
  • HKFC-B 4
  • HTAOK1 4
  • MARKK 4
  • PSK-2 4
  • PSK2 4

External Ids for MIR4523 Gene

Previous GeneCards Identifiers for MIR4523 Gene

  • GC17U901636
  • GC17P027721

Summaries for MIR4523 Gene

Entrez Gene Summary for MIR4523 Gene

  • microRNAs (miRNAs) are short (20-24 nt) non-coding RNAs that are involved in post-transcriptional regulation of gene expression in multicellular organisms by affecting both the stability and translation of mRNAs. miRNAs are transcribed by RNA polymerase II as part of capped and polyadenylated primary transcripts (pri-miRNAs) that can be either protein-coding or non-coding. The primary transcript is cleaved by the Drosha ribonuclease III enzyme to produce an approximately 70-nt stem-loop precursor miRNA (pre-miRNA), which is further cleaved by the cytoplasmic Dicer ribonuclease to generate the mature miRNA and antisense miRNA star (miRNA*) products. The mature miRNA is incorporated into a RNA-induced silencing complex (RISC), which recognizes target mRNAs through imperfect base pairing with the miRNA and most commonly results in translational inhibition or destabilization of the target mRNA. The RefSeq represents the predicted microRNA stem-loop. [provided by RefSeq, Sep 2009]

GeneCards Summary for MIR4523 Gene

MIR4523 (MicroRNA 4523) is an RNA Gene, and is affiliated with the miRNA class. Among its related pathways are Mitotic Metaphase and Anaphase and Cell Cycle, Mitotic. An important paralog of this gene is TAOK3.

UniProtKB/Swiss-Prot for MIR4523 Gene

  • Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating Thr-208 of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.

No data available for Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MIR4523 Gene

Genomics for MIR4523 Gene

Regulatory Elements for MIR4523 Gene

Enhancers for MIR4523 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH17F029450 0.6 ENCODE 12 +59.9 59894 0.2 ZFHX2 ZNF366 HNF4G ZBTB33 NR2F2 EGR2 RXRB RNU6-711P TAOK1 MIR4523 RNU4-34P RNU6-1034P GC17P029533
GH17F029255 1.4 FANTOM5 Ensembl ENCODE 11.3 -133.9 -133908 3.1 PKNOX1 CBX3 ARNT ZNF121 ZNF263 SMARCA5 ZBTB2 CEBPB ZEB2 PBX2 MYO18A NUFIP2 MIR4523 RNU4-34P TAOK1 TIAF1 CRYBA1
GH17F029389 0.5 ENCODE 0.8 +0.3 309 2.3 HDGF PKNOX1 CREB3L1 ARID4B SIN3A DMAP1 ZNF2 YY1 ZNF143 ZNF207 TP53I13 MIR4523 LOC105371931 TAOK1
- Elite enhancer/Elite enhancer-gene association Download Table
Download GeneHancer data dump

Enhancers around MIR4523 on UCSC Golden Path with GeneCards custom track

Promoters for MIR4523 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00001343638 736 3201 HDGF PKNOX1 CREB3L1 ARID4B SIN3A DMAP1 ZNF2 YY1 ZNF143 ZNF207

Genomic Location for MIR4523 Gene

Chromosome:
17
Start:
29,390,464 bp from pter
End:
29,551,904 bp from pter
Size:
161,441 bases
Orientation:
Plus strand

Genomic View for MIR4523 Gene

Genes around MIR4523 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MIR4523 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MIR4523 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MIR4523 Gene

Proteins for MIR4523 Gene

  • Protein details for MIR4523 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    Q7L7X3-TAOK1_HUMAN
    Recommended name:
    Serine/threonine-protein kinase TAO1
    Protein Accession:
    Q7L7X3
    Secondary Accessions:
    • A2RUT8
    • B7ZLV6
    • Q96L75
    • Q9H2K7
    • Q9H7S5
    • Q9P2I6

    Protein attributes for MIR4523 Gene

    Size:
    1001 amino acids
    Molecular mass:
    116070 Da
    Quaternary structure:
    • Self-associates. Interacts with MAP2K3 (By similarity). Interacts with SPRED1 and TESK1. Interacts with MAP3K7.
    • Self-associates. Interacts with MAP2K3 (By similarity). Interacts with SPRED1 and TESK1. Interacts with MAP3K7.
    SequenceCaution:
    • Sequence=BAA92599.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};

    Alternative splice isoforms for MIR4523 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MIR4523 Gene

Selected DME Specific Peptides for MIR4523 Gene

Q7L7X3:
  • DIKAGNIL
  • KKMSYSGKQ
  • ELLNAYQSKIK
  • LQHQTEL
  • LENKLKAEMDEHRLRLDKDLETQRNNF
  • DEAQEAECQ
  • QALRLDE
  • LEQRVSL
  • THGALQGLAYLHSH
  • WSHNPTGG
  • TCKIQTRQYKALR
  • QIKKQFQ
  • QEHEQDS
  • FVLRERP
  • EIGHGSFGAVYFA
  • LECRRFKRRMLL
  • ENQSTPK
  • YDGKVDV
  • EKWQDIIKEV
  • WSLGITCIELAER
  • RKEQLKEEL
  • VKLADFG
  • QTQKDLE
  • QELEFRHL
  • EYKGCYL
  • KAGNILL
  • ERIRSLLERQAREIEAFD
  • ERELRRK
  • SPPQVSRHKSHYRNREHFATIRTASLVTRQ
  • MNAMSALYHIAQN
  • SGYKRMRRQHQKQL
  • HRDIKAGN
  • WMAPEVI
  • QHFQAEEEANLLRRQRQYL
  • SRSTSVTSQ
  • EQTRKLAILAEQY
  • SDDKSELDMMEGDHTVMSNSSVIHLKPEEENY
  • LKDPEIAELFFKEDPE
  • IEEEMLALQ
  • EWSDYFRNFVDSCL
  • HLLETTPK
  • GSNQSIPSMSISASSQSSSV
  • EKKFQQHIQAQQKKELN
  • GTPYWMAPE
  • VLIDLIQRTKDAVRELDNLQYRKMKK
  • NQLEYNKRRE

Post-translational modifications for MIR4523 Gene

  • Autophosphorylated (By similarity). Phosphorylated by ATM in response to DNA damage. Phosphorylated by LRRK2.
  • Proteolytically processed by caspase-3 (CASP3).
  • Modification sites at PhosphoSitePlus
  • Modification sites at neXtProt

Other Protein References for MIR4523 Gene

Domains & Families for MIR4523 Gene

Gene Families for MIR4523 Gene

Protein Domains for MIR4523 Gene

Graphical View of Domain Structure for InterPro Entry

Q7L7X3

UniProtKB/Swiss-Prot:

TAOK1_HUMAN :
  • Contains 1 protein kinase domain.
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
Domain:
  • Contains 1 protein kinase domain.
Family:
  • Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
genes like me logo Genes that share domains with MIR4523: view

No data available for Suggested Antigen Peptide Sequences for MIR4523 Gene

Function for MIR4523 Gene

Molecular function for MIR4523 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.
UniProtKB/Swiss-Prot EnzymeRegulation:
Serine/threonine-protein kinase activity is inhibited by SPRED1.
UniProtKB/Swiss-Prot Function:
Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating Thr-208 of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.
UniProtKB/Swiss-Prot Induction:
In response to DNA damage.

Enzyme Numbers (IUBMB) for MIR4523 Gene

Gene Ontology (GO) - Molecular Function for MIR4523 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004672 protein kinase activity NAS --
GO:0004674 protein serine/threonine kinase activity NAS --
GO:0004702 signal transducer, downstream of receptor, with serine/threonine kinase activity IBA --
GO:0005515 protein binding IPI --
GO:0005524 ATP binding NAS --
genes like me logo Genes that share ontologies with MIR4523: view

Animal Model Products

miRNA Products

Clone Products

Flow Cytometry Products

No data available for Phenotypes , Human Phenotype Ontology , Animal Models , miRNA , Transcription Factor Targets and HOMER Transcription for MIR4523 Gene

Localization for MIR4523 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MIR4523 Gene

Gene Ontology (GO) - Cellular Components for MIR4523 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005737 cytoplasm IEA --
GO:0005829 cytosol TAS --
GO:0070062 extracellular exosome IDA --
genes like me logo Genes that share ontologies with MIR4523: view

No data available for Subcellular locations from COMPARTMENTS for MIR4523 Gene

Pathways & Interactions for MIR4523 Gene

genes like me logo Genes that share pathways with MIR4523: view

Pathways by source for MIR4523 Gene

1 BioSystems pathway for MIR4523 Gene

Gene Ontology (GO) - Biological Process for MIR4523 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006281 DNA repair IEA --
GO:0006468 protein phosphorylation NAS --
GO:0006915 apoptotic process IEA --
GO:0006974 cellular response to DNA damage stimulus IEA --
GO:0007062 sister chromatid cohesion TAS --
genes like me logo Genes that share ontologies with MIR4523: view

No data available for SIGNOR curated interactions for MIR4523 Gene

Transcripts for MIR4523 Gene

mRNA/cDNA for MIR4523 Gene

(7) Ensembl transcripts including schematic representations, and UCSC links where relevant :

miRNA Products

Clone Products

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for MIR4523 Gene

No ASD Table

Relevant External Links for MIR4523 Gene

GeneLoc Exon Structure for
MIR4523
ECgene alternative splicing isoforms for
MIR4523

Expression for MIR4523 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for MIR4523 Gene

mRNA differential expression in normal tissues according to GTEx for MIR4523 Gene

This gene is overexpressed in Testis (x11.4).

NURSA nuclear receptor signaling pathways regulating expression of MIR4523 Gene:

MIR4523

mRNA Expression by UniProt/SwissProt for MIR4523 Gene:

Q7L7X3-TAOK1_HUMAN
Tissue specificity: Highly expressed in the testis, and to a lower extent also expressed in brain, placenta, colon and skeletal muscle.
genes like me logo Genes that share expression patterns with MIR4523: view

No data available for mRNA expression in embryonic tissues and stem cells from LifeMap Discovery , Protein differential expression in normal tissues , Protein expression and Protein tissue co-expression partners for MIR4523 Gene

Orthologs for MIR4523 Gene

This gene was present in the common ancestor of animals.

Orthologs for MIR4523 Gene

Organism Taxonomy Gene Similarity Type Details
cow
(Bos Taurus)
Mammalia TAOK1 35
  • 100 (a)
OneToOne
dog
(Canis familiaris)
Mammalia TAOK1 35
  • 100 (a)
OneToOne
chimpanzee
(Pan troglodytes)
Mammalia TAOK1 35
  • 100 (a)
OneToOne
mouse
(Mus musculus)
Mammalia Taok1 35
  • 99 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia TAOK1 35
  • 99 (a)
OneToOne
oppossum
(Monodelphis domestica)
Mammalia TAOK1 35
  • 98 (a)
OneToOne
chicken
(Gallus gallus)
Aves TAOK1 35
  • 98 (a)
OneToOne
lizard
(Anolis carolinensis)
Reptilia TAOK1 35
  • 95 (a)
OneToOne
zebrafish
(Danio rerio)
Actinopterygii TAOK1 (2 of 3) 35
  • 88 (a)
OneToMany
taok1 35
  • 84 (a)
OneToMany
CU929119.2 35
  • 81 (a)
OneToMany
fruit fly
(Drosophila melanogaster)
Insecta Tao 35
  • 49 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea kin-18 35
  • 38 (a)
OneToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 49 (a)
OneToMany
Species where no ortholog for MIR4523 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rat (Rattus norvegicus)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)

Evolution for MIR4523 Gene

ENSEMBL:
Gene Tree for MIR4523 (if available)
TreeFam:
Gene Tree for MIR4523 (if available)

Paralogs for MIR4523 Gene

Paralogs for MIR4523 Gene

genes like me logo Genes that share paralogs with MIR4523: view

Variants for MIR4523 Gene

Sequence variations from dbSNP and Humsavar for MIR4523 Gene

SNP ID Clin Chr 17 pos Sequence Context AA Info Type
rs114327816 -- 29,388,799(+) GTTCC(A/G)GTTAC upstream-variant-2KB
rs115155599 -- 29,390,182(+) AACTC(C/T)GGGCC upstream-variant-2KB
rs115680333 -- 29,389,923(+) ATTGC(A/G)CTGCC upstream-variant-2KB
rs116323490 -- 29,390,468(+) GGTCC(C/T)GCTCG upstream-variant-2KB
rs11651127 -- 29,389,562(+) cgccc(A/G)cctcg upstream-variant-2KB

Relevant External Links for MIR4523 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MIR4523

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot , Structural Variations from Database of Genomic Variants (DGV) and Variation tolerance for MIR4523 Gene

Disorders for MIR4523 Gene

Relevant External Links for MIR4523

Atlas of Genetics and Cytogenetics in Oncology and Haematology:
MIR4523

No disorders were found for MIR4523 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MIR4523 Gene

Publications for MIR4523 Gene

  1. An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. (PMID: 24275569) Bian Y. … Zou H. (J. Proteomics 2014) 4 64
  2. Toward a comprehensive characterization of a human cancer cell phosphoproteome. (PMID: 23186163) Zhou H. … Mohammed S. (J. Proteome Res. 2013) 4 64
  3. Initial characterization of the human central proteome. (PMID: 21269460) Burkard T.R. … Colinge J. (BMC Syst. Biol. 2011) 4 64
  4. System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. (PMID: 21406692) Rigbolt K.T. … Blagoev B. (Sci. Signal. 2011) 4 64
  5. Deep sequencing of the small RNA transcriptome of normal and malignant human B cells identifies hundreds of novel microRNAs. (PMID: 20733160) Jima D.D. … Dave S.S. (Blood 2010) 3 64

Products for MIR4523 Gene

Sources for MIR4523 Gene

Content
Loading form....