Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MGRN1 Gene

Aliases for MGRN1 Gene

  • Mahogunin Ring Finger 1 2 3 5
  • Mahogunin Ring Finger 1, E3 Ubiquitin Protein Ligase 2 3
  • Mahogunin RING Finger Protein 1 3 4
  • RING Finger Protein 156 3 4
  • RNF156 3 4
  • Probable E3 Ubiquitin-Protein Ligase MGRN1 3
  • E3 Ubiquitin-Protein Ligase MGRN1 3
  • Mahogunin, Ring Finger 1 2
  • EC 6.3.2.- 4
  • KIAA0544 4
  • EC 6.3.2 61

External Ids for MGRN1 Gene

Previous GeneCards Identifiers for MGRN1 Gene

  • GC16P004708
  • GC16P004675
  • GC16P004614
  • GC16P004674

Summaries for MGRN1 Gene

Entrez Gene Summary for MGRN1 Gene

  • Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.[supplied by OMIM, Apr 2004]

GeneCards Summary for MGRN1 Gene

MGRN1 (Mahogunin Ring Finger 1) is a Protein Coding gene. Among its related pathways are Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and ubiquitin-protein transferase activity. An important paralog of this gene is RNF157.

UniProtKB/Swiss-Prot for MGRN1 Gene

  • E3 ubiquitin-protein ligase. Mediates monoubiquitination at multiple sites of TSG101 in the presence of UBE2D1, but not of UBE2G1, nor UBE2H. Plays a role in the regulation of endosome-to-lysosome trafficking. Impairs MC1R- and MC4R-signaling by competing with GNAS-binding to MCRs and inhibiting agonist-induced cAMP production. Does not inhibit ADRB2-signaling. Does not promote MC1R ubiquitination.

No data available for Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MGRN1 Gene

Genomics for MGRN1 Gene

Regulatory Elements for MGRN1 Gene

Enhancers for MGRN1 Gene
GeneHancer Identifier Enhancer Score Enhancer Sources Gene-Enhancer Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor Binding Sites within enhancer Gene Targets for Enhancer
GH16F004681 1.3 FANTOM5 Ensembl ENCODE 45 +66.2 66193 1.9 CTCF ZNF146 CBX3 ZIC2 RAD21 ZNF2 ZNF335 GATA3 FOS THAP11 MGRN1 ZNF500 CORO7 ROGDI MIR6769A NUDT16L1
GH16F004658 1.6 FANTOM5 Ensembl ENCODE 33.3 +46.1 46060 7.3 MLX ARID4B DMAP1 ZNF48 YY1 SLC30A9 FOS SP5 NFYC ZHX2 MGRN1 NUDT16L1 PPL SEPT12 CORO7 GLYR1 NAGPA ENSG00000278700 MIR6769A
GH16F004675 1.1 Ensembl ENCODE 46.5 +61.7 61732 6.3 CTCF MAX SIN3A ZNF48 ZIC2 RARA YY1 ZKSCAN1 HIC1 ZNF121 MGRN1 ZNF500 MIR6769A NUDT16L1
GH16F004692 1 ENCODE 29.4 +77.7 77730 4.3 HDGF ATF1 PKNOX1 CREB3L1 ZNF493 ARID4B SIN3A DMAP1 ZNF48 YY1 MGRN1 ZNF500 CREBBP ALG1 HMOX2 NUDT16L1 GC16P004728
GH16F004701 0.8 ENCODE 34.6 +85.9 85935 1.3 TFAP4 SAP130 MLX ARID4B RAD21 RARA POLR2A SCRT2 NR2F6 GATAD2A MGRN1 NUDT16L1 GC16P004728
- Elite enhancer and/or Elite enhancer-gene association Download GeneHancer data dump

Enhancers around MGRN1 on UCSC Golden Path with GeneCards custom track

Promoters for MGRN1 Gene
Ensembl Regulatory Elements (ENSRs) TSS Distance (bp) Size (bp) Binding Sites for Transcription Factors within promoters
ENSR00000050738 107 1201 HDGF PKNOX1 ARNT CREB3L1 ARID4B SIN3A DMAP1 YY1 ZNF143 FOS
ENSR00001799221 -1993 1801 HDGF CREB3L1 MLX ARID4B SIN3A DMAP1 ZNF2 YY1 SLC30A9 ZNF207

Genomic Location for MGRN1 Gene

Chromosome:
16
Start:
4,616,493 bp from pter
End:
4,690,974 bp from pter
Size:
74,482 bases
Orientation:
Plus strand

Genomic View for MGRN1 Gene

Genes around MGRN1 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MGRN1 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MGRN1 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MGRN1 Gene

Proteins for MGRN1 Gene

  • Protein details for MGRN1 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O60291-MGRN1_HUMAN
    Recommended name:
    E3 ubiquitin-protein ligase MGRN1
    Protein Accession:
    O60291
    Secondary Accessions:
    • A4URL3
    • A4URL4
    • Q86W76

    Protein attributes for MGRN1 Gene

    Size:
    552 amino acids
    Molecular mass:
    60753 Da
    Quaternary structure:
    • Interacts with MC1R and MC4R, but not with TBXA2R. Interacts with TSG101. Interacts with mislocalized cytosolically exposed PRNP; this interaction alters MGRN1 subcellular location and causes lysosomal enlargement (By similarity).
    SequenceCaution:
    • Sequence=BAA25470.1; Type=Erroneous initiation; Evidence={ECO:0000305};

    Alternative splice isoforms for MGRN1 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MGRN1 Gene

Selected DME Specific Peptides for MGRN1 Gene

O60291:
  • IPSAPLYEEI
  • CADTLRYQANNCPICRLPFRALLQIRAVRKK
  • VTGHAHVLLAAFE
  • RPVQFPYVTPA
  • SHFFMGGEKFDTPHPEGYLFGENMDLNFLG
  • QQFSLPSFKIDF
  • SETVHYKRG

Post-translational modifications for MGRN1 Gene

Domains & Families for MGRN1 Gene

Gene Families for MGRN1 Gene

Protein Domains for MGRN1 Gene

Suggested Antigen Peptide Sequences for MGRN1 Gene

Graphical View of Domain Structure for InterPro Entry

O60291

UniProtKB/Swiss-Prot:

MGRN1_HUMAN :
  • The RING finger is required for ubiquitin ligase activity.
  • Contains 1 RING-type zinc finger.
Domain:
  • The RING finger is required for ubiquitin ligase activity.
Similarity:
  • Contains 1 RING-type zinc finger.
genes like me logo Genes that share domains with MGRN1: view

Function for MGRN1 Gene

Molecular function for MGRN1 Gene

UniProtKB/Swiss-Prot Function:
E3 ubiquitin-protein ligase. Mediates monoubiquitination at multiple sites of TSG101 in the presence of UBE2D1, but not of UBE2G1, nor UBE2H. Plays a role in the regulation of endosome-to-lysosome trafficking. Impairs MC1R- and MC4R-signaling by competing with GNAS-binding to MCRs and inhibiting agonist-induced cAMP production. Does not inhibit ADRB2-signaling. Does not promote MC1R ubiquitination.

Enzyme Numbers (IUBMB) for MGRN1 Gene

Gene Ontology (GO) - Molecular Function for MGRN1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0004842 ubiquitin-protein transferase activity IDA 17229889
GO:0005515 protein binding IPI 17229889
GO:0008270 zinc ion binding IEA --
GO:0016874 ligase activity IEA --
GO:0046872 metal ion binding IEA --
genes like me logo Genes that share ontologies with MGRN1: view
genes like me logo Genes that share phenotypes with MGRN1: view

Animal Model Products

Flow Cytometry Products

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for MGRN1 Gene

Localization for MGRN1 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MGRN1 Gene

Early endosome. Note=The endosomal localization is dependent on the interaction with TSG101.
Isoform 1: Cytoplasm, cytosol. Nucleus. Note=Translocation from the cytosol to the nucleus is seen only in the presence of MC1R and MC4R, but not TBXA2R. Excluded from nucleoli.
Isoform 2: Cytoplasm, cytosol. Nucleus. Note=Translocation from the cytosol to the nucleus is seen only in the presence of MC1R and MC4R, but not TBXA2R. Excluded from nucleoli.
Isoform 3: Cytoplasm, cytosol. Cell membrane.
Isoform 4: Cytoplasm, cytosol. Cell membrane.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MGRN1 gene
Compartment Confidence
plasma membrane 5
extracellular 5
nucleus 5
cytosol 5
endosome 5
lysosome 1

Gene Ontology (GO) - Cellular Components for MGRN1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005634 nucleus IEA,IDA 17229889
GO:0005737 cytoplasm IEA,IDA 17229889
GO:0005768 endosome IEA --
GO:0005769 early endosome IEA,IDA 17229889
GO:0005829 cytosol IEA --
genes like me logo Genes that share ontologies with MGRN1: view

Pathways & Interactions for MGRN1 Gene

genes like me logo Genes that share pathways with MGRN1: view

UniProtKB/Swiss-Prot O60291-MGRN1_HUMAN

  • Pathway: Protein modification; protein ubiquitination.

Gene Ontology (GO) - Biological Process for MGRN1 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000209 protein polyubiquitination IEA --
GO:0006513 protein monoubiquitination IMP 17229889
GO:0008333 endosome to lysosome transport IMP 17229889
GO:0016567 protein ubiquitination IEA --
GO:0043951 negative regulation of cAMP-mediated signaling IDA 19737927
genes like me logo Genes that share ontologies with MGRN1: view

No data available for SIGNOR curated interactions for MGRN1 Gene

Drugs & Compounds for MGRN1 Gene

(3) Drugs for MGRN1 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Phosphoric acid Approved Pharma 0
Adenosine monophosphate Approved Nutra 0
Adenosine triphosphate Approved Nutra 0

(1) Additional Compounds for MGRN1 Gene - From: HMDB

Name Synonyms Role CAS Number PubChem IDs PubMed IDs
pyrophosphate
  • (4-)Diphosphoric acid ion
  • (P2O74-)Diphosphate
  • Diphosphate
  • Diphosphoric acid
  • PPi
14000-31-8
genes like me logo Genes that share compounds with MGRN1: view

Transcripts for MGRN1 Gene

Unigene Clusters for MGRN1 Gene

Mahogunin ring finger 1, E3 ubiquitin protein ligase:
Representative Sequences:

Flow Cytometry Products

Alternative Splicing Database (ASD) splice patterns (SP) for MGRN1 Gene

ExUns: 1a · 1b ^ 2 ^ 3 ^ 4 ^ 5a · 5b ^ 6 ^ 7a · 7b ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13 ^ 14 ^ 15 ^ 16 ^ 17 ^ 18a · 18b ^ 19 ^ 20 ^ 21a · 21b ^
SP1: - - - - - -
SP2: - - - -
SP3: - - - - -
SP4: - - -
SP5: -
SP6: -
SP7: -
SP8:
SP9:

ExUns: 22a · 22b
SP1:
SP2:
SP3:
SP4:
SP5:
SP6:
SP7:
SP8:
SP9:

Relevant External Links for MGRN1 Gene

GeneLoc Exon Structure for
MGRN1
ECgene alternative splicing isoforms for
MGRN1

Expression for MGRN1 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and SAGE for MGRN1 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for MGRN1 Gene

This gene is overexpressed in Fetal Brain (32.2), Retina (7.0), and Frontal cortex (6.9).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MGRN1 Gene



Protein tissue co-expression partners for MGRN1 Gene

NURSA nuclear receptor signaling pathways regulating expression of MGRN1 Gene:

MGRN1

SOURCE GeneReport for Unigene cluster for MGRN1 Gene:

Hs.526494
genes like me logo Genes that share expression patterns with MGRN1: view

Primer Products

No data available for mRNA differential expression in normal tissues and mRNA Expression by UniProt/SwissProt for MGRN1 Gene

Orthologs for MGRN1 Gene

This gene was present in the common ancestor of eukaryotes.

Orthologs for MGRN1 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MGRN1 34 35
  • 99.28 (n)
cow
(Bos Taurus)
Mammalia -- 35
  • 91 (a)
OneToMany
MGRN1 34 35
  • 87.21 (n)
dog
(Canis familiaris)
Mammalia MGRN1 34 35
  • 87.68 (n)
oppossum
(Monodelphis domestica)
Mammalia -- 35
  • 87 (a)
OneToMany
-- 35
  • 71 (a)
OneToMany
mouse
(Mus musculus)
Mammalia Mgrn1 34 16 35
  • 86.07 (n)
rat
(Rattus norvegicus)
Mammalia Mgrn1 34
  • 85.49 (n)
platypus
(Ornithorhynchus anatinus)
Mammalia MGRN1 35
  • 84 (a)
OneToOne
chicken
(Gallus gallus)
Aves MGRN1 34 35
  • 78.64 (n)
lizard
(Anolis carolinensis)
Reptilia MGRN1 35
  • 78 (a)
OneToOne
tropical clawed frog
(Silurana tropicalis)
Amphibia mgrn1 34
  • 75.76 (n)
zebrafish
(Danio rerio)
Actinopterygii mgrn1a 35
  • 70 (a)
OneToMany
mgrn1b 34 35
  • 69.88 (n)
wufi38c03 34
fruit fly
(Drosophila melanogaster)
Insecta CG9941 35
  • 28 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea C11H1.3 35
  • 30 (a)
OneToMany
rice
(Oryza sativa)
Liliopsida Os01g0374900 34
  • 53.39 (n)
sea squirt
(Ciona savignyi)
Ascidiacea -- 35
  • 40 (a)
OneToMany
Species where no ortholog for MGRN1 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • baker's yeast (Saccharomyces cerevisiae)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • wheat (Triticum aestivum)

Evolution for MGRN1 Gene

ENSEMBL:
Gene Tree for MGRN1 (if available)
TreeFam:
Gene Tree for MGRN1 (if available)

Paralogs for MGRN1 Gene

Paralogs for MGRN1 Gene

(1) SIMAP similar genes for MGRN1 Gene using alignment to 7 proteins:

genes like me logo Genes that share paralogs with MGRN1: view

Variants for MGRN1 Gene

Sequence variations from dbSNP and Humsavar for MGRN1 Gene

SNP ID Clin Chr 16 pos Sequence Context AA Info Type
rs1045517 -- 4,687,155(+) ACCTT(C/T)TGGAA intron-variant, utr-variant-3-prime
rs1045518 -- 4,690,440(+) ATGAG(C/G)TCCGC nc-transcript-variant, upstream-variant-2KB, utr-variant-3-prime
rs1045519 -- 4,690,443(-) GAGGC(A/G)GACCT nc-transcript-variant, upstream-variant-2KB, utr-variant-3-prime
rs1045520 -- 4,690,476(+) CAGCA(C/T)GGTCC nc-transcript-variant, upstream-variant-2KB, utr-variant-3-prime
rs1075443 -- 4,650,092(-) tgccc(A/G)gcctc intron-variant

Structural Variations from Database of Genomic Variants (DGV) for MGRN1 Gene

Variant ID Type Subtype PubMed ID
nsv1160333 CNV deletion 26073780
nsv1113749 CNV deletion 24896259
nsv1050237 CNV loss 25217958
nsv1046986 CNV gain 25217958
esv3637699 CNV loss 21293372
esv3553043 CNV deletion 23714750
esv28573 CNV gain 19812545
esv2671090 CNV deletion 23128226
esv2659384 CNV deletion 23128226

Variation tolerance for MGRN1 Gene

Residual Variation Intolerance Score: 19.4% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 3.80; 58.34% of all genes are more intolerant (likely to be disease-causing)

Relevant External Links for MGRN1 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MGRN1

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MGRN1 Gene

Disorders for MGRN1 Gene

Relevant External Links for MGRN1

Genetic Association Database (GAD)
MGRN1
Human Genome Epidemiology (HuGE) Navigator
MGRN1
Atlas of Genetics and Cytogenetics in Oncology and Haematology:
MGRN1

No disorders were found for MGRN1 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MGRN1 Gene

Publications for MGRN1 Gene

  1. Mahogunin ring finger-1 (MGRN1) E3 ubiquitin ligase inhibits signaling from melanocortin receptor by competition with Galphas. (PMID: 19737927) Perez-Oliva A.B. … Garcia-Borron J.C. (J. Biol. Chem. 2009) 3 4 22 64
  2. Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. (PMID: 9628581) Nagase T. … Ohara O. (DNA Res. 1998) 2 3 4 64
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose J.E. … Uhl G.R. (Mol. Med. 2010) 3 46 64
  4. Pigmentation-related genes and their implication in malignant melanoma susceptibility. (PMID: 19320733) Fernandez L.P. … Ribas G. (Exp. Dermatol. 2009) 3 46 64
  5. Abnormal regulation of TSG101 in mice with spongiform neurodegeneration. (PMID: 19703557) Jiao J. … Gunn T.M. (Biochim. Biophys. Acta 2009) 3 4 64

Products for MGRN1 Gene

Sources for MGRN1 Gene

Content
Loading form....