Set Analyses:
Advanced Search

Advanced Search

 
Search By
Section (entire)
for


 
or upload a file of gene symbols


Category   Symbol Source: HGNC EntrezGene Ensembl GeneCards RNA genes CroW21
GIFtS

MGAT5 Gene

protein-coding   GIFtS: 56
GCID: GC02P134842

mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase

 Explore 40 diseases affiliated with
MGAT5 via our new
 Human Malady Compendium 
Biological research products
for MGAT5
    

(According to 1HGNC, 2Entrez Gene,
3UniProtKB/Swiss-Prot, 4UniProtKB/TrEMBL, 5OMIM, 6GeneLoc, 7Ensembl, 8DME, 9miRBase, and/or 10fRNAdb)
About This Section

Aliases
Mannosyl (Alpha-1,6-)-Glycoprotein
Beta-1,6-N-Acetyl-Glucosaminyltransferase1 2
     N-Acetylglucosaminyl-Transferase V2 3
GNT-V1 2 3     EC 2.4.1.1553 8
Alpha-Mannoside Beta-1,6-N-Acetylglucosaminyltransferase2 3     GNT-VA2
GlcNAc-T V2 3     Alpha-1,6-Mannosylglycoprotein 6-Beta-N-Acetylglucosaminyltransferase A2
Mannoside Acetylglucosaminyltransferase 52 3     GGNT53

External Ids:    HGNC: 70491   Entrez Gene: 42492   Ensembl: ENSG000001521277   OMIM: 6017745   UniProtKB: Q093283   

Export aliases for MGAT5 gene to outside databases

Previous GC identifers: GC02P132654 GC02P133296 GC02P135031 GC02P135219 GC02P134725 GC02P134594 GC02P127004


(According to Entrez Gene, Tocris Bioscience, Wikipedia's Gene Wiki, PharmGKB,
UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL)
About This Section

Entrez Gene summary for MGAT5:
The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of
beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly
synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of
glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant
changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated
with the progression of invasive malignancies. (provided by RefSeq, Oct 2011)

UniProtKB/Swiss-Prot: MGT5A_HUMAN, Q09328
Function: Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary
N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of
glycoprotein oligosaccharides

Gene Wiki entry for MGAT5


(According to GeneLoc and/or HGNC, and/or
Entrez Gene (NCBI build 37),
and/or miRBase,
Genomic Views according to UCSC (hg19) and Ensembl (release 69), Regulatory elements and Epigenetics data according to QIAGEN, SABiosciences, and/or SwitchGear Genomics)
About This Section
RefSeq DNA sequence:
NC_000002.11  NC_018913.1  NT_022135.16  
Regulatory elements:
   SABiosciences Regulatory transcription factor binding sites in the MGAT5 gene promoter:
         c-Fos   AP-1   AML1a   POU2F1   POU2F1a   c-Jun   MIF-1   
         Other transcription factors

SwitchGear Promoter luciferase reporter plasmidMGAT5 promoter sequence
   Search SABiosciences Chromatin IP Primers for MGAT5

Epigenetics:
QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat MGAT5


Genomic Location:
Genomic View: UCSC Golden Path with GeneCards custom track

Entrez Gene cytogenetic band: 2q21.3   Ensembl cytogenetic band:  2q21.2   HGNC cytogenetic band: 2q21

MGAT5 Gene in genomic location: bands according to Ensembl, locations according to (and/or Entrez Gene and/or Ensembl if different)
MGAT5 gene location

GeneLoc information about chromosome 2         GeneLoc Exon Structure

GeneLoc location for GC02P134842:  view genomic region     (about GC identifiers)

Start:
134,877,554 bp from pter      End:
135,212,192 bp from pter
Size:
334,639 bases      Orientation:
plus strand

(According to 1UniProtKB, HORDE, neXtProt, Ensembl, and/or Reactome, Modification sites according to 2PhosphoSitePlus, Specific Peptides from DME, Protein expression images according to data from SPIRE MOPED and PaxDb, RefSeq according to NCBI, PDB rendering according to OCA and/or Proteopedia, Recombinant Proteins from EMD Millipore, R&D Systems, GenScript, Enzo Life Sciences, OriGene, Novus Biologicals, Sino Biological, ProSpec, and/or Uscn,
Biochemical Assays by EMD Millipore, R&D Systems, OriGene, GenScript, Cell Signaling Technology, Enzo Life Sciences, and/or Uscn, Ontologies according to Gene Ontology Consortium 01 Mar 2013 and Entrez Gene, Antibodies by EMD Millipore, R&D Systems, GenScript, Cell Signaling Technology, OriGene, Novus Biologicals, Thermo Fisher Scientific, Abcam, and/or Uscn)
About This Section

UniProtKB/Swiss-Prot: MGT5A_HUMAN, Q09328 (See protein sequence)
Recommended Name: Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A  
Size: 741 amino acids; 84543 Da
Subcellular location: Golgi apparatus membrane; Single-pass type II membrane protein
Secondary accessions: D3DP70

Explore the universe of human proteins at neXtProt for MGAT5: NX_Q09328

Post-translational modifications:

  • View modification sites using PhosphoSitePlus2
  • View neXtProt modification sites for NX_Q09328

  • 4/5 DME Specific Peptides for MGAT5 (Q09328) (see all 5)
     KDILVPSF  NSTNSTTAVPSLV  CSFFIYLSEVENWCP  QEKCVLPPMDGYPHCEGKIKWMKDMWRSDPCYADYGVDG 

    MGAT5 Protein expression data from MOPED and PaxDb:    About this image 
    Estimated protein expression log10 (pmol).

    REFSEQ proteins: NP_002401.1  
    ENSEMBL proteins: 
     ENSP00000386377   ENSP00000281923  
    Reactome Protein details: Q09328
    Human Recombinant Protein Products: 
    Browse Purified and Recombinant Proteins at EMD Millipore
    R&D Systems Recombinant & Natural Proteins for MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5)
    Browse recombinant and purified proteins available from Enzo Life Sciences
    Browse OriGene full length recombinant human proteins expressed in human HEK293 cells
    Browse OriGene Protein Over-expression Lysates
    OriGene Custom Protein Services for MGAT5 
    GenScript Custom Purified and Recombinant Proteins Services for MGAT5
    Novus Biologicals MGAT5 Protein
    Browse Sino Biological Recombinant Proteins
    Browse ProSpec Recombinant Proteins
    Uscn Proteins for MGAT5

    Gene Ontology (GO): 2 cellular component terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0000139Golgi membrane TAS--
    GO:0016021integral to membrane NAS--


    MGAT5 for ontologies           About GeneDecksing



    MGAT5 Antibody Products: 
    Browse EMD Millipore's Extensive Line of Mono- and Polyclonal Antibodies
    R&D Systems Antibodies for MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5)
    Browse OriGene Antibodies
    OriGene Custom Antibody Services for MGAT5 
    GenScript Custom Superior Antibodies Services for MGAT5
    Novus Biologicals MGAT5 Antibodies
    Search for Antibodies for MGAT5 at Abcam  
    Uscn Antibodies for MGAT5
    Search ThermoFisher Antibodies for MGAT5

    Assay Products for MGAT5: 
    Browse Kits and Assays available from EMD Millipore
    OriGene Custom Immunoassay Development
    Browse OriGene Fluorogenic Cell Assay Kits
    Browse R&D Systems for biochemical assays
    GenScript Custom Assay Services for MGAT5
    Browse Enzo Life Sciences for kits & assays
    Uscn ELISAs and CLIAs for MGAT5


    (According to InterPro, ProtoNet, UniProtKB, and/or BLOCKS, Sets of similar genes according to GeneDecks)
    About This Section

    MGAT5 for domains           About GeneDecksing

    1 InterPro domain/family:
     IPR026116 GlyclTrfase_18

    Graphical View of Domain Structure for InterPro Entry Q09328

    ProtoNet protein and cluster: Q09328

    UniProtKB/Swiss-Prot: MGT5A_HUMAN, Q09328
    Similarity: Belongs to the glycosyltransferase 18 family


    (According to 1UniProtKB, Genatlas, LifeMap Discovery™, IUBMB, and/or 2DME, Human phenotypes from GenomeRNAi, Animal models from MGI Mar 06 2013,
    bound targets from SABiosciences, miRNA Gene Targets from miRTarBase shRNA from OriGene, RNAi from EMD Millipore, siRNAs from OriGene, QIAGEN, microRNA from QIAGEN, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, SwitchGear Genomics, GenScript, Sino Biological, DNA2.0, and Vector BioLabs, Cell Lines from GenScript, LifeMap BioReagents, In Situ Hybridization Assays from Advanced Cell Diagnostics, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene.)
    About This Section

    Function Summary:

         UniProtKB/Swiss-Prot: MGT5A_HUMAN, Q09328
    Function: Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary
    N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of
    glycoprotein oligosaccharides
    Catalytic activity: UDP-N-acetyl-D-glucosamine +
    6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP +
    6-(2,6-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R

         Genatlas biochemistry entry for MGAT5:
    mannosyl (alpha-1,6-) glycoprotein beta-1,6-N-acetylglucosaminyltransferase,Golgi,biosynthesis of complex Asn-linked
    (N) glycans

    Enzyme Number (IUBMB): EC 2.4.1.1551 2

    miRNA
    Products:
        
    Browse 3'-UTR reporter clones for miRNA target validation
    Browse MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat MGAT5
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate MGAT5
    Browse SwitchGear 3'UTR luciferase reporter plasmids
    Inhib. RNA
    Products:
        
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for MGAT5 (see all 7)
    OriGene shRNA RFP: MGAT5
    OriGene siRNA: MGAT5
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat MGAT5

    Gene Editing
    Products:
    DNA2.0 Custom Protein Engineering Service for MGAT5

    Clone
    Products:
         
    Browse Clones for the Expression of Recombinant Proteins Available from EMD Millipore
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for MGAT5 (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for MGAT5
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: MGAT5 (NM_002410)
    Sino Biological Human cDNA Clone for MGAT5
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for MGAT5
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat MGAT5 

    Cell Line
    Products:
         
    GenScript Custom overexpressing Cell Line Services for MGAT5
    Search LifeMap BioReagents cell lines for MGAT5

    In Situ Assay
    Products:
       

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for MGAT5

    Gene Ontology (GO): 2 molecular function terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0008375acetylglucosaminyltransferase activity ----
    GO:0030144alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity NAS8292036


    MGAT5 for ontologies           About GeneDecksing


    2 GenomeRNAi human phenotypes for MGAT5:
     Increased gamma-H2AX phosphory  Large cells 

    Animal Models:
         6 MGI mutant phenotypes (inferred from 1 allele(MGI details for Mgat5):
     behavior/neurological  homeostasis/metabolism  immune system  nervous system  renal/urinary system 
     tumorigenesis 

    MGAT5 for phenotypes           About GeneDecksing


    (Pathways according to EMD Millipore, R&D Systems, Cell Signaling Technology, KEGG, PharmGKB, BioSystems, Reactome, Tocris Bioscience, GeneGo (Thomson Reuters), QIAGEN, and/or UniProtKB, Sets of similar genes according to GeneDecks, Interaction Networks according to SABiosciences, and/or STRING, Interactions according to 1UniProtKB, 2MINT, 3I2D, and/or 4STRING, with links to IntAct and Ensembl, Ontologies according to Gene Ontology Consortium 01 Mar 2013 via Entrez Gene).
    About This Section

    Unified GeneCards pathways  About this table 
    See pathways by source

    Super-pathwaycontained gene-specific pathways
    1Asparagine N-linked glycosylation
    Asparagine N-linked glycosylation1.00
    Post-translational protein modification0.44
    N-Glycan biosynthesis0.52
    Metabolism of proteins0.15
    2N-glycan antennae elongation in the medial/trans-Golgi
    N-glycan antennae elongation in the medial/trans-Golgi1.00
    Transport to the Golgi and subsequent modification0.56
    N-Glycan antennae elongation0.75
    3Metabolism
    Metabolic pathways0.38

    Pathway sources
    See GeneCards unified pathways
    Show all pathways


    5/6        Reactome Pathways for MGAT5 (see all 6)
        N-glycan antennae elongation in the medial/trans-Golgi
    Transport to the Golgi and subsequent modification
    Asparagine N-linked glycosylation
    N-Glycan antennae elongation
    Metabolism of proteins


    2         Kegg Pathways  (Kegg details for MGAT5):
        N-Glycan biosynthesis
    Metabolic pathways

    UniProtKB/Swiss-Prot: MGT5A_HUMAN, Q09328
    Pathway: Protein modification; protein glycosylation


    MGAT5 for pathways           About GeneDecksing

    Interactions:

        SABiosciences Gene Network CentralTM Interacting Genes and Proteins Network for MGAT5

    STRING Interaction Network Preview (showing 3 interactants - click image to see more details)

    3 Interacting proteins for MGAT5 (ENSP000002819234) via UniProtKB, MINT, STRING, and/or I2D

    InteractantInteraction Details
    GeneCardExternal ID(s)
    MGAT4AENSP000002649684STRING: ENSP00000264968
    MGAT4BENSP000003384874STRING: ENSP00000338487
    MGAT4CENSP000003316644STRING: ENSP00000331664
    About this table

    Gene Ontology (GO): 4 biological process terms (GO ID links to tree view):    About this table

    GO IDQualified GO termEvidencePubMed IDs
    GO:0006487protein N-linked glycosylation NAS--
    GO:0018279protein N-linked glycosylation via asparagine TAS--
    GO:0043687post-translational protein modification TAS--
    GO:0044267cellular protein metabolic process TAS--


    MGAT5 for ontologies           About GeneDecksing



    (Chemical Compounds according to UniProtKB, Enzo Life Sciences, EMD Millipore, Tocris Bioscience HMDB, BitterDB, and/or Novoseek, and Drugs according to DrugBank, Enzo Life Sciences, and/or PharmGKB, with drugs/clinical trials/news search links to CenterWatch)
    About This Section

    MGAT5 for compounds           About GeneDecksing

    Browse Small Molecules at EMD Millipore
    Browse drugs & compounds from Enzo Life Sciences

    Browse Tocris compounds for MGAT5

    2 HMDB Compounds for MGAT5    About this table
    CompoundSynonyms CAS #PubMed Ids
    Uridine 5'-diphosphate5'-UDP (see all 9)58-98-0--
    Uridine diphosphate-N-acetylglucosamineN-[2-[[[5-[(2,4-dioxo-1H-pyrimidin-1-yl)]-3,4-dihydroxy-tetrahydrofuran-2-yl]methoxy-hydroxy-phosphinoyl]oxy-hydroxy-phosphinoyl]oxy-4,5-dihydroxy-6-(hydroxymethyl)tetrahydropyran-3-yl]acetamide (see all 30)528-04-1--
    10/16 Novoseek chemical compound relationships for MGAT5 gene (see all 16)    About this table
    Compound   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    beta-d-mannoside 83.7 1 15189346 (1)
    n-acetylglucosamine 72.6 21 10815896 (2), 19787216 (1), 8393437 (1), 8900148 (1) (see all 10)
    polysaccharide 65.8 19 15809094 (3), 19846557 (2), 11315257 (2), 11501752 (1) (see all 10)
    ebdc 64.8 4 15238704 (2), 15138129 (1)
    polylactosamine 54 3 8900148 (1), 15840653 (1)
    n-acetyllactosamine 51.4 1 11511814 (1)
    mannose 50.9 2 8428922 (1), 16413118 (1)
    udp-n-acetylglucosamine 46.9 3 8393437 (1), 8900148 (1)
    matrigel 44.2 3 10972975 (1), 11315257 (1), 12460896 (1)
    retinoic acid 40 36 17031849 (3), 19960509 (2), 10699467 (2), 16411021 (2) (see all 9)

    Search CenterWatch for drugs/clinical trials and news about MGAT5 / MGT5A 

    (Secondary structures according to fRNAdb,
    GenBank/EMBL/DDBJ Accessions according to
    Unigene (Build 235 Homo sapiens; Mar 10 2013) or GenBank,
    RefSeq according to Entrez Gene,
    DOTS (version 10), and/or AceView, transcript ids from Ensembl with links to UCSC,
    exon structure from GeneLoc, alternative splicing isoforms according to ASD and/or ECgene,
    RNAi Products from EMD Millipore,
    siRNAs from OriGene, QIAGEN, shRNA from OriGene, microRNA from QIAGEN,
    Tagged/untagged cDNA clones from OriGene, SwitchGear Genomics, GenScript, DNA2.0, Vector BioLabs, Primers from OriGene, SABiosciences, and/or QIAGEN )
    About This Section

    REFSEQ mRNAs for MGAT5 gene: 
    NM_002410.4  

    Unigene Cluster for MGAT5:

    Mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase
    Hs.4988  [show with all ESTs]
    Unigene Representative Sequence: NM_002410
    5 Ensembl transcripts including schematic representations, and UCSC links where relevant:
    ENST00000481801 ENST00000468758 ENST00000409645(uc002ttw.4) ENST00000488365
    ENST00000281923

    miRNA
    Products:
         
    Browse 3'-UTR reporter clones for miRNA target validation
    Browse OriGene MicroRNA Expression Plasmids
    QIAGEN Custom miScript Target Protector blocks miRNA-binding site of human, mouse, rat MGAT5
    Search QIAGEN for miScript miRNA Assays for microRNAs that regulate MGAT5
    Browse SwitchGear 3'UTR luciferase reporter plasmids
    Inhib. RNA
    Products:
         
    Browse for Gene Knock-down Tools from EMD Millipore
    OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for MGAT5 (see all 7)
    OriGene shRNA RFP: MGAT5
    OriGene siRNA: MGAT5
    QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat MGAT5
    Clone
    Products:
         
    OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for MGAT5 (see all 3)
    OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for MGAT5
    OriGene custom cloning services – gene synthesis, subcloning, mutagenesis, variant library, vector shuttling 
    GenScript: all cDNA clones in your preferred vector: MGAT5 (NM_002410)
    DNA2.0 Custom Codon Optimized Gene Synthesis Service for MGAT5
    Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat MGAT5 
    Primer
    Products:
        
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for MGAT5
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat MGAT5
      QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat MGAT5
      QIAGEN QuantiFast Probe-based Assays in human, mouse, rat MGAT5

    Additional cDNA sequence: 

    AF055029.1 AF113921.1 AK056461.1 AK125207.1 BC041917.1 BX647087.1 D17716.1 

    8 DOTS entries:

    DT.97808004  DT.445584  DT.75129808  DT.101962674  DT.100658584  DT.95117248  DT.95172280  DT.99950244 

    24/309 AceView cDNA sequences (see all 309):

    F09656 BX103343 CF136139 BF589867 AI129353 BM853776 BM787503 AA721306 
    BM842023 D17716 AA337355 AW500199 BU428594 AI986179 BM844897 Z38698 
    AU125276 BU628863 BM687834 BQ773562 AA769725 AU140909 BU431458 F10546 

    GeneLoc Exon Structure


    (RNA expression data according to H-InvDB, NONCODE, miRBase, and RNAdb, Expression images according to data from BioGPS, Illumina Human BodyMap, and CGAP SAGE, Sets of similar genes according to GeneDecks, in vivo and in vitro expression data from LifeMap Discovery™, plus additional links to Genevestigator, and/or SOURCE, and/or BioGPS, and/or UniProtKB,
    PCR Arrays from SABiosciences, Primers from OriGene, SABiosciences, and/or QIAGEN, In Situ Hybridization Assays from Advanced Cell Diagnostics)
    About This Section

    MGAT5 expression in normal human tissues (normalized intensities)
    See probesets specificity/sensitivity at GeneAnnot
    About this imageBioGPS
    CGAP TAG: ACTGAATGTT

    Microarray
    RNAseq (Illumina Body Map)
    (100×FPKM)½
    SAGE (Serial Analysis of Gene Expression)

    About this image
    See MGAT5 Protein Expression from SPIRE MOPED and PaxDB
    Genevestigator expression for MGAT5

    SOURCE GeneReport for Unigene cluster: Hs.4988
        SABiosciences Expression via Pathway-Focused PCR Arrays including MGAT5: 
              Glycosylation in human mouse rat
              Tumor Metastasis in human mouse rat

    Primer
    Products:
    OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for MGAT5
    Browse OriGene validated miRNA SYBR primer pairs
    SABiosciences RT2 qPCR Primer Assay in human, mouse, rat MGAT5
    QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat MGAT5
    QIAGEN QuantiFast Probe-based Assays in human, mouse, rat MGAT5
    In Situ
    Assay Products:
     

     
    Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for MGAT5

    (Orthologs according to 1,2HomoloGene (2older version, for species not in 1newer version), 3euGenes, 4SGD , 5MGI Mar 06 2013, with possible further links to Flybase and/or WormBase, and/or 6Ensembl pan taxonomic compara , Gene Trees according to Ensembl and TreeFam)
    About This Section

    This gene was present in the common ancestor of animals.

    Orthologs for MGAT5 gene from 5/16 species (see all 16)    About this table
    Organism Taxonomic
    classification
    Gene Description Human
    Similarity
    Orthology
    Type
    Details
    chicken
    (Gallus gallus)
    Aves MGAT51 mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase 79.9(n)
    87.26(a)
      424286  XM_422131.2  XP_422131.2 
    lizard
    (Anolis carolinensis)
    Reptilia MGAT56
    --
    87(a)
    1 ↔ 1
    1(96169601-96248843)
    African clawed frog
    (Xenopus laevis)
    Amphibia Xl.19262 Xenopus laevis transcribed sequence with moderate similarity more 81.86(n)    BJ069098.1 
    zebrafish
    (Danio rerio)
    Actinopterygii Dr.120832 Transcribed sequence with moderate similarity to protein more 77.09(n)    CK024434.1 
    worm
    (Caenorhabditis elegans)
    Secernentea gly-21 Protein GLY-2 49.49(n)
    39.9(a)
      172360  NM_059473.5  NP_491874.1 


    ENSEMBL Gene Tree for MGAT5 (if available)
    TreeFam Gene Tree for MGAT5 (if available) 

    (Paralogs according to 1HomoloGene,
    2Ensembl, and 3SIMAP, Pseudogenes according to 4Pseudogene.org Build 68)
    About This Section
    Paralogs for MGAT5 gene
    MGAT5B2  
    2 SIMAP similar genes for MGAT5 using alignment to 4 protein entries:     MGT5A_HUMAN (see all proteins):
    CCDC126    MGAT5B

    MGAT5 for paralogs           About GeneDecksing



    (SNPs/Variants according to the 1NCBI SNP Database, 2Ensembl, 3PupaSUITE, UniProtKB, and DNA2.0, Linkage Disequilibrium by HapMap, Structural Variations(CNVs/InDels/Inversions) from the Database of Genomic Variants, Mutations from the Human Gene Mutation Database (HGMD) and the Locus Specific Mutation Databases (LSDB), Blood group antigen gene mutations by BGMUT, Resequencing Primers from QIAGEN, Cancer Mutation PCR Arrays and Assays and Copy Number PCR Arrays from SABiosciences)
    About This Section

    10/3651 NCBI SNPs in MGAT5 are shown (see all 3651    About this table
    Genomic DataTranscription Related DataAllele Frequencies
    SNP IDValidClinical
    significance
    Chr 2 posSequence#AA
    Chg
    TypeMore#Allele
    freq
    PopTotal
    sample
    More
    ----------
    rs729761241,2
    C,F,--127002660(+) CTTACG/ATTATG 1 -- us2k13Minor allele frequency- A:0.08WA 122
    rs758821951,2
    F,--127002734(+) GGAATG/ATATGG 1 -- us2k11Minor allele frequency- A:0.11EA 120
    rs1113588601,2
    --127002865(+) TGGGTG/AGGGCC 1 -- us2k11Minor allele frequency- A:0.50CSA 2
    rs27339501,2
    H--127002887(+) atttcT/Ccactg 1 -- us2k1 ese34Minor allele frequency- C:0.00NS EA 406
    rs768406121,2
    F,--127003255(+) AGAGAC/TGATAA 1 -- us2k11Minor allele frequency- T:0.03EA 120
    rs752994131,2
    --127003278(+) TTACCA/GTATAG 1 -- us2k10--------
    rs786311911,2
    F,--127003321(+) AAGATG/TGTATG 1 -- us2k12Minor allele frequency- T:0.02NA EA 240
    rs67328671,2
    H--127003323(+) GATGGT/GATGTC 1 -- us2k1 ese34Minor allele frequency- G:0.00NS EA 416
    rs1121399731,2
    --127003333(+) CACAAC/TATCTG 1 -- us2k11Minor allele frequency- T:0.50CSA 2
    rs1131970341,2
    --127003460(+) TACCAG/TTTTCT 1 -- us2k11Minor allele frequency- T:0.50CSA 2

    HapMap Linkage Disequilibrium report for MGAT5 (134877554 - 135127554 bp, first 250kb of MGAT5)
    Structural Variations (Copy Number Variations, Insertions/Deletions, Inversions)
          Database of Genomic Variants (DGV) variations for MGAT5: --

    SABiosciences Cancer Mutation PCR Assays
    QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing MGAT5
    DNA2.0 Custom Variant and Variant Library Synthesis for MGAT5

    (in which this Gene is Involved, According to MalaCards, OMIM, UniProtKB, the University of Copenhagen DISEASES database, Novoseek, Genatlas, GeneTests, GAD, HuGE Navigator, and/or TGDB.)
    About This Section

    MGAT5 for disorders           About GeneDecksing

    OMIM gene information: 601774    OMIM disorders: --

    20/40 diseases for MGAT5 (see all 40):    About MalaCards
    diffuse large b-cell lymphoma    wiskott-aldrich syndrome    b-cell lymphomas    congenital dyserythropoietic anemia
    bile duct carcinoma    congenital muscular dystrophy    dyserythropoietic anemia    congenital disorder of glycosylation
    liver cirrhosis    conduct disorder    muscular dystrophy    fibrosarcoma
    hepatocellular carcinoma    colon cancer    multiple sclerosis    breast carcinoma
    colorectal cancer    carcinoma    hepatoblastoma    breast cancer

    10/21 Novoseek disease relationships for MGAT5 gene (see all 21)    About this table

    Disease   -log (P-Val)   Hits   PubMed IDs for Articles with Shared Sentences (# sentences)
    melanoma cloudman s91 75.6 1 14760865 (1)
    hepatocellular carcinoma 58.4 33 11903748 (2), 19960509 (2), 10699467 (2), 17031849 (2) (see all 19)
    metastatic cancer 58.3 8 17878270 (1), 19645485 (1), 10972975 (1)
    metastasis 52.5 57 15452379 (4), 10815896 (4), 11751457 (3), 18931531 (3) (see all 26)
    tumors 40.4 72 11903748 (6), 15014031 (4), 16638859 (3), 16406879 (3) (see all 25)
    melanoma 35.5 8 11751457 (3), 17235237 (2), 17897065 (2), 10571019 (1)
    cancer 33.3 38 10438459 (4), 19787216 (2), 10815896 (2), 10571019 (2) (see all 23)
    sarcoma rous 32.7 2 9235963 (1), 2160776 (1)
    colon cancer 31.9 16 15452379 (6), 17878270 (2), 16404719 (2), 20462175 (1) (see all 5)
    fibrosarcoma 24.3 5 19846557 (1), 12460896 (1), 14561752 (1)

    Human Genome Epidemiology (HuGE) Navigator: MGAT5 (4 documents)

    Export disorders for MGAT5 gene to outside databases

    (in PubMed. Associations of this gene to articles via 1Entrez Gene, 2UniProtKB/Swiss-Prot, 3HGNC, 4GAD, 5PharmGKB, 6HMDB, 7DrugBank, 8UniProtKB/TrEMBL, 9 Novoseek, and/or 10fRNAdb)
    About This Section

    PubMed articles for MGAT5 gene, integrated from 9 sources (see all 157):
    (articles sorted by number of sources associating them with MGAT5)
        Utopia: connect your pdf to the dynamic
    world of online information

    1. cDNA cloning and chromosomal mapping of human N- acetylglucosaminyltransferase V+. (PubMed id 8292036)1, 2, 3, 9 Nishikawa A.... Taniguchi N. (1994)
    2. Characterization of UDP-N-acetylglucosamine: alpha-6-d-mannoside beta-1,6-N-acetylglucosaminyltransferase V from a human hepatoma cell line Hep3B. (PubMed id 10395745)1, 2 Park C.... Kim C.H. (1999)
    3. Expression of N-acetylglucosaminyltransferase v is associated with prognosis and histology in non-small cell lung cancers. (PubMed id 15014031)1, 9 Dosaka-Akita H....Taniguchi N. (2004)
    4. N-acetylglucosaminyltransferase V and beta1-6 branching N-linked oligosaccharides are associated with good prognosis of patients with bladder cancer. (PubMed id 16638859)1, 9 Ishimura H....Ohyama C. (2006)
    5. The implication of N-acetylglucosaminyltransferase V expression in gastric cancer. (PubMed id 18931531)1, 9 Tian H....Matsuura N. (2008)
    6. Expression of N-acetylglucosaminyltransferase V in endometrial cancer correlates with poor prognosis. (PubMed id 17971775)1, 9 Yamamoto E....Kikkawa F. (2007)
    7. The effect of receptor protein tyrosine phosphatase k appa on the change of cell adhesion and proliferation induced by N-acetylglucos aminyltransferase V. (PubMed id 19911372)1, 9 Wang C....Zha X. (2010)
    8. High expression of N-acetylglucosaminyltransferase V in mucinous tumors of the ovary. (PubMed id 19787216)1, 9 Takahashi N....Kikkawa F. (2009)
    9. N-acetylglucosaminyltransferase V regulates extravillous trophoblast invasion through glycosylation of alpha5beta1 integrin. (PubMed id 18845630)1, 9 Yamamoto E....Kikkawa F. (2009)
    10. Down-regulation of N-acetylglucosaminyltransferase-V induces ER stress by changing glycosylation and function of GLUT1. (PubMed id 17451637)1, 9 Li J....Shen Z.H. (2007)

    (in PubMed, OMIM, and NCBI Bookshelf)
    About This Section
     ANDOR
    Aliases
    Disorders
    Free Text  

      Query String
    PubMed
    OMIM
    NCBI Bookshelf
      (Note: In FireFox, select the above section and copy using Ctrl-C)

    (According to Entrez Gene, HGNC, AceView, euGenes, Ensembl, miRBase, ECgene, Kegg, and/or H-InvDB)
    About This Section
    Entrez Gene: 4249 HGNC: 7049 AceView: MGAT5 Ensembl:ENSG00000152127 euGenes: HUgn4249
    ECgene: MGAT5 Kegg: 4249 H-InvDB: MGAT5

    (According to HUGE)
    About This Section
      --

    (According to PharmGKB, ATLAS, HORDE, IMGT, LEIDEN, UniProtKB/Swiss-Prot, and/or UniProtKB/TrEMBL,
    Wikipedia and/or GeneReviews via UniProtKB/Swiss-Prot)
    About This Section
    NameDescription
    PharmGKB entry for MGAT5 Pharmacogenomics, SNPs, Pathways
    ATLAS Chromosomes in Cancer entry for MGAT5 Genetics and Cytogenetics in Oncology and Haematology
    GGDBhttp://riodb.ibase.aist.go.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=MGAT5
    Functional Glycomics Gateway - GTasehttp://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_533

    (Patent information from GeneIP,
    Licensable technologies from WIS Yeda, Salk, Tufts,
    IP news from LifeMap Sciences, Inc.)
    About This Section
    Patent Information for MGAT5 gene:
    Search GeneIP for patents involving MGAT5

    GeneCards and IP:
    Japan Patent Office Licenses GeneCards     European Patent Office Licenses GeneCards     Improving the IP Search



    (Antibodies, recombinant proteins, and assays from EMD Millipore, R&D Systems, OriGene, QIAGEN, GenScript, Cell Signaling Technology, SABiosciences, Novus Biologicals, Sino Biological, Enzo Life Sciences, Abcam, ProSpec, Uscn, Thermo Fisher Scientific, Gene Editing from DNA2.0, Clones from EMD Millipore, OriGene, GenScript, Sino Biological, DNA2.0, SwitchGear Genomics, Vector BioLabs, Cell lines from GenScript and LifeMap BioReagents, PCR Arrays from SABiosciences, Drugs and/or compounds from EMD Millipore, Tocris Bioscience, and/or Enzo Life Sciences),
    In Situ Hybridization Assays from
    Advanced Cell Diagnostics
    About This Section

     
     EMD Millipore Custom Antibody & Bulk Services
     EMD Millipore Preclinical / Clinical Development Services
     EMD Millipore Immunoassay Services
     EMD Millipore Target Screening & Profiling Services

      
     Antibodies for MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5)   Browse Cell Culture Products  
     Browse ELISAs   Browse Flow Cytometry Kits  
     Browse Primer Pairs   Browse Kinase Activity Assays/Reagents  
     Browse ELISpot Kits/Development Modules   Browse TFB/Immunoprecipitation Assays  
     Browse Apoptosis Detection Kits/Reagents   Browse Ubiquitin Proteasome Pathway (UPP) Assay Kits/Reagents  
     Browse DNA Damage/Repair Kits/Reagents   Browse Multiplex/Array Assay Kits/Reagents  
     Browse Cell Selection/Detection Kits/Reagents   Browse Secondary Antibodies/Controls/Staining Reagents  
     Browse Phosphatase Activity Assays/Reagents   Recombinant/Natural Proteins for MGAT5 (N-Acetylglucosaminyltransferase V/MGAT5)  
     Browse OriGene Antibodies   OriGene shRNA RFP for MGAT5  
     OriGene 29mer shRNA kits in GFP-retroviral vector in human, mouse, rat for MGAT5   OriGene genome-wide validated SYBR primer pairs in human, mouse, rat for MGAT5  
     Browse OriGene Protein Over-expression Lysates   Browse OriGene Fluorogenic Cell Assay Kits  
     OriGene siRNA for MGAT5   Browse 3'-UTR reporter clones for miRNA target validation  
     OriGene untagged cDNA clones in CMV expression vector in human, mouse, rat for MGAT5   OriGene Myc/DDK tagged cDNA clones in CMV expression vector in human, mouse, rat for MGAT5  
     Browse OriGene GFP tagged cDNA clones in CMV expression vector   Browse OriGene MicroRNA Expression Plasmids  
     Browse OriGene basic RS shRNAs   Browse OriGene validated miRNA SYBR primer pairs  
     Browse OriGene full length recombinant human proteins expressed in human HEK293 cells   OriGene custom cloning services - gene synthesis, subcloning, mutagenesis, variant library, vector shuttling  
     OriGene Custom Antibody Services for MGAT5   OriGene Custom Protein Services for MGAT5  
     OriGene Custom Immunoassay Development  

     
     
     QIAGEN Custom miScript Target Protector blocks miRNA-binding site of in human, mouse, rat MGAT5
     QIAGEN SeqTarget long-range PCR primers in human, mouse, rat for resequencing MGAT5
     QIAGEN PyroMark CpG Assay predesigned Pyrosequencing DNA Methylation assays in human, mouse, rat MGAT5
     QIAGEN FlexiTube/FlexiPlate siRNA for gene silencing in human, mouse, rat MGAT5
     QIAGEN QuantiFast Probe-based Assays in human, mouse, rat MGAT5
     QIAGEN QuantiTect SYBR Green Assays in human, mouse, rat MGAT5
     GenScript Custom Purified and Recombinant Proteins Services for MGAT5 GenScript cDNA clones with any tag delivered in your preferred vector for MGAT5
     GenScript Custom Assay Services for MGAT5 GenScript Custom Superior Antibodies Services for MGAT5
     GenScript Custom overexpressing Cell Line Services for MGAT5 CloneReady with Over 120,000 Genes
     Gene Synthesis: Any Gene in Any Vector Vector-based siRNA and miRNA, Ready for Transfection
     Gene Mutant Library, Variants up to 10^11 Plasmid Preparation
     Custom Peptide Services
     Search for Antibodies & Assays

     Regulatory tfbs in MGAT5 promoter
     Search Chromatin IP Primers for MGAT5
     RT2 qPCR Primer Assay in human, mouse, rat MGAT5
     GNC Network for MGAT5
     SABiosciences PCR Arrays including human, mouse, rat MGAT5
     Search Tocris compounds for MGAT5
     Browse Sino Biological Proteins and Antibodies
     cDNA Clones for MGAT5
     Antibodies/Proteins Production Services
     Rabbit Monoclonal Antibody Platform
     Bulk Purchasing
     Search www.enzolifesciences.com for proteins, assays, substrates, inhibitors & antibodies
     Novus Tissue Slides
     MGAT5 antibodies
     MGAT5 proteins
     Search for Antibodies for MGAT5 at Abcam
     See all of Abcam's Antibodies, Kits and Proteins for MGAT5
     Custom Antibody / Protein Production Service
     Bulk Purchasing
     Advantages of Rabbit Monoclonal antibodies
     Abcam protocols and scientific support
     Browse ProSpec Recombinant Proteins




     MGAT5 Proteins, Antibodies, CLIAs, and ELISAs
     Search LifeMap BioReagents cell lines for MGAT5
     Gene Synthesis
     Protein Engineering
     Variant Library Synthesis
     Codon Optimization
     Protein Production and Purification
     Advanced Cell Diagnostics RNAscope RNA in situ hybridization assays for MGAT5
     Browse SwitchGear 3'UTR luciferase reporter plasmids for MGAT5
     SwitchGear Promoter luciferase reporter plasmids for MGAT5
     Search ThermoFisher Antibodies for MGAT5
     Vector BioLabs ready-to-use adenovirus/AAV for human, mouse, rat MGAT5
           
    GeneCards Homepage - Last full update: 19 Mar 2013 - Incrementals: 21 Mar 2013 , 15 Apr 2013 , 26 Apr 2013

    View Random Gene

    Category
    VWF
    (GIFTS: 73)
    von Willebrand factor
    GIFtS Group
    The GeneCards human gene database gene index: 1 3 5 6 A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 


    Developed at the Crown Human Genome Center, Department of Molecular Genetics, the Weizmann Institute of Science

    Hot genes      Disease genes      MGAT5 gene at Home site.
    hostname: 356977-web1.xennexinc.com index build: 100 solr: 1.4