Free for academic non-profit institutions. Other users need a Commercial license

Aliases for MAST4 Gene

Aliases for MAST4 Gene

  • Microtubule Associated Serine/Threonine Kinase Family Member 4 2 3 5
  • EC 2.7.11.1 4 56
  • EC 2.7.11 56
  • KIAA0303 4

External Ids for MAST4 Gene

Previous GeneCards Identifiers for MAST4 Gene

  • GC05P066291
  • GC05P065929
  • GC05P065892
  • GC05P062849

Summaries for MAST4 Gene

Entrez Gene Summary for MAST4 Gene

  • This gene encodes a member of the microtubule-associated serine/threonine protein kinases. The proteins in this family contain a domain that gives the kinase the ability to determine its own scaffold to control the effects of their kinase activities. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]

GeneCards Summary for MAST4 Gene

MAST4 (Microtubule Associated Serine/Threonine Kinase Family Member 4) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MAST2.

Additional gene information for MAST4 Gene

No data available for CIViC summary , UniProtKB/Swiss-Prot , Tocris Summary , Gene Wiki entry , PharmGKB "VIP" Summary , fRNAdb sequence ontologies and piRNA Summary for MAST4 Gene

Genomics for MAST4 Gene

GeneHancer (GH) Regulatory Elements for MAST4 Gene

Promoters and enhancers for MAST4 Gene
GeneHancer (GH) Identifier GH Type GH
Score
GH Sources Gene Association Score Total Score TSS distance (kb) Number of Genes Away Size (kb) Transcription Factor
Binding Sites
Gene Targets
GH05I067002 Promoter/Enhancer 2.2 EPDnew Ensembl ENCODE dbSUPER 550 +409.2 409201 6 PKNOX1 SMAD1 FOXA2 ARNT ARID4B SIN3A DMAP1 ZNF2 YY1 POLR2B MAST4-AS1 MAST4 SREK1 CD180 GC05P067163
GH05I066595 Promoter/Enhancer 2.1 EPDnew Ensembl ENCODE 550.8 +0.9 938 3 PKNOX1 ATF1 SIN3A ZNF2 GLIS2 KLF7 FOS KLF13 SP3 SP5 GC05P066599 MAST4 SREK1 GC05M066555
GH05I066828 Promoter/Enhancer 2 EPDnew Ensembl ENCODE dbSUPER 550.1 +233.4 233433 3.4 CTCF MXI1 PKNOX1 USF1 JUN INSM2 FEZF1 ZNF2 RAD21 HIC1 MAST4 GC05M066555 GC05M066727
GH05I066957 Promoter/Enhancer 2 EPDnew Ensembl ENCODE dbSUPER 550.1 +363.1 363079 3.7 FOXA2 ZFP64 MZF1 SIN3A FEZF1 ZNF335 ZNF121 ZNF366 ZSCAN5C SCRT2 MAST4 SREK1 GC05M066555 MAST4-AS1
GH05I066981 Enhancer 0.9 dbSUPER 19 +386.1 386126 1.3 ZSCAN4 INSM2 MZF1 FEZF1 ZNF2 ZEB1 ZNF213 ZNF366 ZSCAN5C ZNF391 MAST4 SREK1 MAST4-AS1 GC05M066555
- Elite GeneHancer and/or Elite GeneHancer-gene association Download GeneHancer data dump

GeneHancers around MAST4 on UCSC Golden Path with GeneCards custom track

Top Transcription factor binding sites by QIAGEN in the MAST4 gene promoter:

Genomic Locations for MAST4 Gene

Genomic Locations for MAST4 Gene
chr5:66,596,348-67,169,598
(GRCh38/hg38)
Size:
573,251 bases
Orientation:
Plus strand
chr5:65,892,176-66,465,423
(GRCh37/hg19)

Genomic View for MAST4 Gene

Genes around MAST4 on UCSC Golden Path with GeneCards custom track

Cytogenetic band:
MAST4 Gene in genomic location: bands according to Ensembl, locations according to GeneLoc (and/or Entrez Gene and/or Ensembl if different)
Genomic Location for MAST4 Gene
GeneLoc Logo Genomic Neighborhood Exon StructureGene Density

RefSeq DNA sequence for MAST4 Gene

Proteins for MAST4 Gene

  • Protein details for MAST4 Gene (UniProtKB/Swiss-Prot)

    Protein Symbol:
    O15021-MAST4_HUMAN
    Recommended name:
    Microtubule-associated serine/threonine-protein kinase 4
    Protein Accession:
    O15021
    Secondary Accessions:
    • A6NL49
    • B5ME48
    • Q05EE6
    • Q6ZN07
    • Q8N4X4
    • Q96LY3

    Protein attributes for MAST4 Gene

    Size:
    2626 amino acids
    Molecular mass:
    284378 Da
    Cofactor:
    Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
    Quaternary structure:
    No Data Available

    Three dimensional structures from OCA and Proteopedia for MAST4 Gene

    Alternative splice isoforms for MAST4 Gene

    UniProtKB/Swiss-Prot:

neXtProt entry for MAST4 Gene

Selected DME Specific Peptides for MAST4 Gene

O15021:
  • MMNHVYKERFPKATAQMEE
  • AETVLALEYLH
  • LYEFLVGCVPFFGDTPEELFGQV
  • LTDFGLSK
  • FFRSLDW
  • RPRSRSL
  • CSFETRRHLCMVMEYVEGGDCATL
  • CGTPEYIAPE
  • KLTDFGL
  • DGRRWSLASLPSSGYGTNTPSSTVSSSCSSQE
  • SYRSTPD
  • HIRPSTLHGL
  • ELARDCL
  • TTTPFENTSI
  • ESDFETIKLISNGAYGAVY
  • DELHFLSKHF
  • KSAGNIPLSPLA
  • RSLSPGR
  • LPRPHSPL
  • GHIKLTD
  • GKPVDWWA
  • RPARLLECLEF
  • PRSPLLKRVQS
  • GHIKLTDFGLSK
  • KELSLPRRG
  • IKLTDFG
  • SPQRSPSPL
  • GIVHRDLKPDN
  • ARDCLDKS
  • LHQLPYQPT
  • FVERDILTFAENPFVV
  • VHRDLKP
  • LLEAAEGHAKEG
  • IVHRDLK

Post-translational modifications for MAST4 Gene

No Post-translational modifications

Domains & Families for MAST4 Gene

Graphical View of Domain Structure for InterPro Entry

O15021

UniProtKB/Swiss-Prot:

MAST4_HUMAN :
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
Family:
  • Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
genes like me logo Genes that share domains with MAST4: view

Function for MAST4 Gene

Molecular function for MAST4 Gene

UniProtKB/Swiss-Prot CatalyticActivity:
ATP + a protein = ADP + a phosphoprotein.

Enzyme Numbers (IUBMB) for MAST4 Gene

Phenotypes From GWAS Catalog for MAST4 Gene

Gene Ontology (GO) - Molecular Function for MAST4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0000287 magnesium ion binding IEA --
GO:0004672 protein kinase activity IEA --
GO:0004674 protein serine/threonine kinase activity IEA,IBA --
GO:0005524 ATP binding IEA --
GO:0016301 kinase activity IEA --
genes like me logo Genes that share ontologies with MAST4: view
genes like me logo Genes that share phenotypes with MAST4: view

miRNA for MAST4 Gene

Clone Products

  • Addgene plasmids for MAST4

No data available for Human Phenotype Ontology , Animal Models , Transcription Factor Targets and HOMER Transcription for MAST4 Gene

Localization for MAST4 Gene

Subcellular locations from UniProtKB/Swiss-Prot for MAST4 Gene

Cytoplasm.

Subcellular locations from

COMPARTMENTS
Extracellular space Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi Apparatus Nucleus Mitochondrion 0 1 2 3 4 5 Confidence
COMPARTMENTS Subcellular localization image for MAST4 gene
Compartment Confidence
cytosol 4
nucleus 2

Subcellular locations from the

Human Protein Atlas (HPA)
  • Cytosol (2)
  • Nucleoplasm (2)
See all subcellular structures

Gene Ontology (GO) - Cellular Components for MAST4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0005622 intracellular IBA --
GO:0005737 cytoplasm IEA --
genes like me logo Genes that share ontologies with MAST4: view

Pathways & Interactions for MAST4 Gene

SuperPathways for MAST4 Gene

No Data Available

Gene Ontology (GO) - Biological Process for MAST4 Gene

GO ID Qualified GO term Evidence PubMed IDs
GO:0006468 protein phosphorylation IEA --
GO:0007010 NOT cytoskeleton organization IBA --
GO:0016310 phosphorylation IEA --
GO:0018105 peptidyl-serine phosphorylation IBA --
GO:0035556 intracellular signal transduction IBA --
genes like me logo Genes that share ontologies with MAST4: view

No data available for Pathways by source and SIGNOR curated interactions for MAST4 Gene

Drugs & Compounds for MAST4 Gene

(2) Drugs for MAST4 Gene - From: HMDB

Name Status Disease Links Group Role Mechanism of Action Clinical Trials
Magnesium Approved Nutra 0
ATP Investigational Nutra Agonist 0
genes like me logo Genes that share compounds with MAST4: view

Transcripts for MAST4 Gene

Unigene Clusters for MAST4 Gene

Microtubule associated serine/threonine kinase family member 4:
Representative Sequences:

Clone Products

  • Addgene plasmids for MAST4

Alternative Splicing Database (ASD) splice patterns (SP) for MAST4 Gene

ExUns: 1 ^ 2 ^ 3 ^ 4 ^ 5 ^ 6 ^ 7 ^ 8 ^ 9 ^ 10 ^ 11 ^ 12 ^ 13a · 13b ^ 14 ^ 15 ^ 16 ^ 17a · 17b ^ 18a · 18b · 18c ^ 19 ^ 20 ^ 21 ^ 22 ^
SP1: -
SP2:
SP3: - -
SP4:

ExUns: 23 ^ 24 ^ 25 ^ 26
SP1:
SP2:
SP3:
SP4:

Relevant External Links for MAST4 Gene

GeneLoc Exon Structure for
MAST4
ECgene alternative splicing isoforms for
MAST4

Expression for MAST4 Gene

mRNA expression in normal human tissues from GTEx, Illumina, BioGPS, and CGAP SAGE for MAST4 Gene

mRNA expression in embryonic tissues and stem cells from LifeMap Discovery

Protein differential expression in normal tissues from HIPED for MAST4 Gene

This gene is overexpressed in Lung (12.2), Plasma (9.7), Cervix (7.6), and Adrenal (7.4).

Integrated Proteomics: protein expression in normal tissues and cell lines from ProteomicsDB, PaxDb, MaxQB, and MOPED for MAST4 Gene



NURSA nuclear receptor signaling pathways regulating expression of MAST4 Gene:

MAST4

SOURCE GeneReport for Unigene cluster for MAST4 Gene:

Hs.595458

mRNA Expression by UniProt/SwissProt for MAST4 Gene:

O15021-MAST4_HUMAN
Tissue specificity: Highly expressed in most normal human tissues, with an exception of in testis, small intestine, colon and peripheral blood leukocyte.

Evidence on tissue expression from TISSUES for MAST4 Gene

  • Nervous system(4.6)
  • Lung(4.4)
  • Liver(4.2)
genes like me logo Genes that share expression patterns with MAST4: view

No data available for mRNA differential expression in normal tissues , Protein tissue co-expression partners and Phenotype-based relationships between genes and organs from Gene ORGANizer for MAST4 Gene

Orthologs for MAST4 Gene

This gene was present in the common ancestor of animals and fungi.

Orthologs for MAST4 Gene

Organism Taxonomy Gene Similarity Type Details
chimpanzee
(Pan troglodytes)
Mammalia MAST4 33 34
  • 99.22 (n)
dog
(Canis familiaris)
Mammalia MAST4 33 34
  • 86.7 (n)
cow
(Bos Taurus)
Mammalia MAST4 33 34
  • 84.35 (n)
mouse
(Mus musculus)
Mammalia Mast4 33 16 34
  • 81.94 (n)
rat
(Rattus norvegicus)
Mammalia Mast4 33
  • 81.29 (n)
oppossum
(Monodelphis domestica)
Mammalia MAST4 34
  • 73 (a)
OneToOne
platypus
(Ornithorhynchus anatinus)
Mammalia MAST4 34
  • 73 (a)
OneToOne
chicken
(Gallus gallus)
Aves MAST4 33 34
  • 68.18 (n)
lizard
(Anolis carolinensis)
Reptilia MAST4 34
  • 63 (a)
OneToOne
zebrafish
(Danio rerio)
Actinopterygii mast4 34
  • 76 (a)
OneToOne
fruit fly
(Drosophila melanogaster)
Insecta CG6498 34
  • 33 (a)
OneToMany
worm
(Caenorhabditis elegans)
Secernentea kin-4 34
  • 31 (a)
OneToMany
baker's yeast
(Saccharomyces cerevisiae)
Saccharomycetes KIN82 34
  • 26 (a)
ManyToMany
FPK1 34
  • 24 (a)
ManyToMany
sea squirt
(Ciona savignyi)
Ascidiacea -- 34
  • 41 (a)
OneToMany
Species where no ortholog for MAST4 was found in the sources mined by GeneCards:
  • A. gosspyii yeast (Ashbya gossypii)
  • Actinobacteria (Mycobacterium tuberculosis)
  • African clawed frog (Xenopus laevis)
  • African malaria mosquito (Anopheles gambiae)
  • Alicante grape (Vitis vinifera)
  • alpha proteobacteria (Wolbachia pipientis)
  • amoeba (Dictyostelium discoideum)
  • Archea (Pyrococcus horikoshii)
  • barley (Hordeum vulgare)
  • beta proteobacteria (Neisseria meningitidis)
  • bread mold (Neurospora crassa)
  • Chromalveolata (Phytophthora infestans)
  • common water flea (Daphnia pulex)
  • corn (Zea mays)
  • E. coli (Escherichia coli)
  • filamentous fungi (Aspergillus nidulans)
  • Firmicute bacteria (Streptococcus pneumoniae)
  • fission yeast (Schizosaccharomyces pombe)
  • green algae (Chlamydomonas reinhardtii)
  • honey bee (Apis mellifera)
  • K. lactis yeast (Kluyveromyces lactis)
  • loblloly pine (Pinus taeda)
  • malaria parasite (Plasmodium falciparum)
  • medicago trunc (Medicago Truncatula)
  • moss (Physcomitrella patens)
  • orangutan (Pongo pygmaeus)
  • pig (Sus scrofa)
  • rainbow trout (Oncorhynchus mykiss)
  • rice (Oryza sativa)
  • rice blast fungus (Magnaporthe grisea)
  • schistosome parasite (Schistosoma mansoni)
  • sea anemone (Nematostella vectensis)
  • sea urchin (Strongylocentrotus purpuratus)
  • sorghum (Sorghum bicolor)
  • soybean (Glycine max)
  • stem rust fungus (Puccinia graminis)
  • sugarcane (Saccharum officinarum)
  • thale cress (Arabidopsis thaliana)
  • tomato (Lycopersicon esculentum)
  • toxoplasmosis (Toxoplasma gondii)
  • Trichoplax (Trichoplax adhaerens)
  • tropical clawed frog (Silurana tropicalis)
  • wheat (Triticum aestivum)

Evolution for MAST4 Gene

ENSEMBL:
Gene Tree for MAST4 (if available)
TreeFam:
Gene Tree for MAST4 (if available)

Paralogs for MAST4 Gene

Variants for MAST4 Gene

Sequence variations from dbSNP and Humsavar for MAST4 Gene

SNP ID Clin Chr 05 pos Variation AA Info Type
VAR_040791 A lung squamous cell carcinoma sample p.Glu2470Asp
rs1000002595 -- 67,130,792(+) C/G genic_downstream_transcript_variant, intron_variant
rs1000013841 -- 66,621,896(+) G/T genic_upstream_transcript_variant, intron_variant
rs1000020850 -- 67,027,452(+) A/G genic_downstream_transcript_variant, genic_upstream_transcript_variant, intron_variant
rs1000025778 -- 67,094,143(+) C/T genic_downstream_transcript_variant, intron_variant

Structural Variations from Database of Genomic Variants (DGV) for MAST4 Gene

Variant ID Type Subtype PubMed ID
dgv1103e214 CNV loss 21293372
dgv9829n54 CNV loss 21841781
esv2028067 CNV deletion 18987734
esv2079875 CNV deletion 18987734
esv2439275 CNV deletion 19546169
esv24501 CNV loss 19812545
esv2496676 CNV deletion 19546169
esv2580346 CNV deletion 19546169
esv2656889 CNV deletion 23128226
esv2662158 CNV deletion 23128226
esv2662343 CNV deletion 23128226
esv2666110 CNV deletion 23128226
esv2676812 CNV deletion 23128226
esv2676830 CNV deletion 23128226
esv2730281 CNV deletion 23290073
esv2759347 CNV gain 17122850
esv3304484 CNV mobile element insertion 20981092
esv3309638 CNV mobile element insertion 20981092
esv3397260 CNV insertion 20981092
esv34053 CNV loss 18971310
esv34119 CNV loss 18971310
esv3447124 CNV insertion 20981092
esv3570177 CNV loss 25503493
esv3570178 CNV loss 25503493
esv3570179 CNV loss 25503493
esv3570180 CNV loss 25503493
esv3605315 CNV loss 21293372
esv3605316 CNV loss 21293372
esv3605318 CNV loss 21293372
esv3605322 CNV loss 21293372
esv3605323 CNV loss 21293372
esv3605324 CNV gain 21293372
esv3605326 CNV loss 21293372
esv3605327 CNV loss 21293372
nsv1023631 CNV gain 25217958
nsv1030944 CNV loss 25217958
nsv1123953 CNV deletion 24896259
nsv1124913 CNV duplication 24896259
nsv1161254 CNV duplication 26073780
nsv507257 OTHER sequence alteration 20534489
nsv508365 CNV deletion 20534489
nsv509970 OTHER sequence alteration 20534489
nsv516753 CNV loss 19592680
nsv522181 CNV loss 19592680
nsv598407 CNV loss 21841781
nsv950075 CNV duplication 24416366

Variation tolerance for MAST4 Gene

Residual Variation Intolerance Score: 8.35% of all genes are more intolerant (likely to be disease-causing)
Gene Damage Index Score: 6.22; 76.12% of all genes are more intolerant (likely to be disease-causing)

Additional Variant Information for MAST4 Gene

SNPedia medical, phenotypic, and genealogical associations of SNPs for
MAST4

No data available for Polymorphic Variants from UniProtKB/Swiss-Prot for MAST4 Gene

Disorders for MAST4 Gene

Additional Disease Information for MAST4

Genetic Association Database
(GAD)
Human Genome Epidemiology Navigator
(HuGE)
ATLAS of Genetics and Cytogenetics in Oncology and Haematology

No disorders were found for MAST4 Gene.

No data available for MalaCards , UniProtKB/Swiss-Prot and Genatlas for MAST4 Gene

Publications for MAST4 Gene

  1. Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. (PMID: 9205841) Nagase T … Ohara O (DNA research : an international journal for rapid publication of reports on genes and genomes 1997) 2 3 4 58
  2. A genome-wide association study of carotid atherosclerosis in HIV-infected men. (PMID: 20009918) Shrestha S … Grunfeld C (AIDS (London, England) 2010) 3 44 58
  3. Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. (PMID: 20379614) Rose JE … Uhl GR (Molecular medicine (Cambridge, Mass.) 2010) 3 44 58
  4. [Identification of a novel human MAST4 gene, a new member of the microtubule associated serine-threonine kinase family]. (PMID: 17086981) Sun L … Mao Y (Molekuliarnaia biologiia 2006) 3 4 58
  5. Complete sequencing and characterization of 21,243 full-length human cDNAs. (PMID: 14702039) Ota T … Sugano S (Nature genetics 2004) 3 4 58

Products for MAST4 Gene

  • Addgene plasmids for MAST4

Sources for MAST4 Gene

Content
Loading form....